PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G052000.1.p
Common NameGLYMA_12G052000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 264aa    MW: 29717.2 Da    PI: 6.6412
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G052000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR192.64.9e-2988175291
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                          fYn+YA++vGF vr+sk ++s+r+g+ + rt+vC+keg+r  +k++  k  r+raetr+gC+a+++v+k ++gkw+++k+++eH+H+l+p
  Glyma.12G052000.1.p  88 FYNAYATDVGFIVRVSKLSRSRRDGTAIGRTLVCNKEGFRMADKRE--KIVRQRAETRVGCRAMIMVRKLSSGKWVIAKFVKEHTHPLTP 175
                          ******************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.3E-2688175IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MEVEIDGSVT VETVGNTAMG EVSSIADDNR EGGSSVEPND KQDQHDNMTQ DSSGGITIPT  60
AIPTVSVVSV EEPYVGQEFG SEAAAHAFYN AYATDVGFIV RVSKLSRSRR DGTAIGRTLV  120
CNKEGFRMAD KREKIVRQRA ETRVGCRAMI MVRKLSSGKW VIAKFVKEHT HPLTPGKGRR  180
DFYYEQYPTE QDKIRELSQQ LATEKKRSAA YKRHLELIFE QIEEQNENLS KKIQHIVDSV  240
KEMEAKEEHS RQWEGDGSQR RTY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0944940.0BT094494.1 Soybean clone JCVI-FLGm-18B16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006591856.10.0PREDICTED: uncharacterized protein LOC100777092 isoform X1
TrEMBLA0A0R0HE970.0A0A0R0HE97_SOYBN; Uncharacterized protein
STRINGGLYMA12G05600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24533072
Representative plantOGRP10299610
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.22e-89FAR1 family protein