PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G033000.1.p
Common NameGLYMA_12G033000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bZIP
Protein Properties Length: 272aa    MW: 29548 Da    PI: 6.8258
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G033000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.21.7e-0889138251
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          k++   +r   N+eA r++R++Kka+ + Le++v +L a N+ L k+l+ 
  Glyma.12G033000.1.p  89 KSSSSKKRSLGNKEAVRKYREKKKARAASLEDEVVKLRALNQHLMKKLKG 138
                          56667899999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.8E-1285156No hitNo description
SMARTSM003385.0E-788155IPR004827Basic-leucine zipper domain
PfamPF077164.9E-1189145IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-792137No hitNo description
CDDcd146868.84E-11100147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MDDGELDFSN HEVFSSPNMG ELPSSGSMDS FFDELLKDTH ACTHTHTCNP PGPDFSHTHT  60
CYHVHTKIVP APEEDHVATD DTAESAEKKS SSSKKRSLGN KEAVRKYREK KKARAASLED  120
EVVKLRALNQ HLMKKLKGQA ALEAEIARLK CLLVDIRGRI EGEIGSFPYQ KPTPNANPPV  180
ANLPGSYVMN PCNLQCDDRV YCHHPYGKIG ESAALNGEEF DGCEFENLQC LASQNLGLKD  240
LRACGVGQAR SNVNSSASNK RKGGSHAVTA G*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286300.0cotyledon| hypocotyl| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.12G033000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2354190.0AC235419.1 Glycine max strain Williams 82 clone GM_WBb0136G05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006591924.10.0bZIP transcription factor bZIP122 isoform X1
RefseqXP_006591929.10.0bZIP transcription factor bZIP122 isoform X1
RefseqXP_028194237.10.0basic leucine zipper 23-like isoform X1
RefseqXP_028194238.10.0basic leucine zipper 23-like isoform X1
SwissprotQ8GTS21e-110BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A445HK490.0A0A445HK49_GLYSO; Basic leucine zipper 23 isoform A
TrEMBLI1LPT10.0I1LPT1_SOYBN; Uncharacterized protein
STRINGGLYMA12G03690.50.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-94bZIP family protein
Publications ? help Back to Top
  1. Liao Y, et al.
    Soybean GmbZIP44, GmbZIP62 and GmbZIP78 genes function as negative regulator of ABA signaling and confer salt and freezing tolerance in transgenic Arabidopsis.
    Planta, 2008. 228(2): p. 225-40
    [PMID:18365246]
  2. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  3. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  4. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]