PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G251500.11.p
Common NameGLYMA_11G251500, LOC100796013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 441aa    MW: 48333.6 Da    PI: 7.5565
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G251500.11.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.3e-42172248278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           CqvegC  dls+ak+yhr+h+vCe+hsk+p+v+++gle+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Glyma.11G251500.11.p 172 CQVEGCGLDLSSAKDYHRKHRVCEAHSKSPKVVITGLERRFCQQCSRFHALSEFDDKKRSCRRRLSDHNARRRKPQP 248
                           **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-34164233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.753169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-39170251IPR004333Transcription factor, SBP-box
PfamPF031103.2E-32172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MECNAKSLGQ WDWEHLFFFN TKAAENPRLQ PTDCSSEADR EINVGMLHPS GGSACSGSEL  60
IHASSSRSSK SASNNSSSNG DSKASILTLE GSHDDSTGKK ELCNGEPIET SPAAVPSPVS  120
GEPLLTLKLG KRLYFEDVCT GSDSKKPSSF DIPISSGKKH KTSSQTLQHP SCQVEGCGLD  180
LSSAKDYHRK HRVCEAHSKS PKVVITGLER RFCQQCSRFH ALSEFDDKKR SCRRRLSDHN  240
ARRRKPQPDS IQLNPSALSS SPYDGRQIVS PFAFSRTATN LAWQDMHPQT KEFLPKPAKA  300
FNKIPSIVSM LSDDSSGLLT SRGIATKSTV PGMEDPIRLS DPNGTQDVNR ALSLLSTNSS  360
SSWGAYETKS LSLEHSTRAT HSITQHHLPL PSSAEYWHTD HQQHSSMCIS FTDCDSSNRF  420
QDFQLLSSPY ESPFPCNQLD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271722451184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227244KKRSCRRRLSDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.386230.0cotyledon| flower| pod| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G251500.11.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939850.0BT093985.1 Soybean clone JCVI-FLGm-24F23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025980067.10.0uncharacterized protein LOC100796013 isoform X2
RefseqXP_028197927.10.0squamosa promoter-binding-like protein 2 isoform X2
TrEMBLA0A0R0HM160.0A0A0R0HM16_SOYBN; Uncharacterized protein
TrEMBLA0A445HIC60.0A0A445HIC6_GLYSO; Squamosa promoter-binding-like protein 12 isoform G
STRINGGLYMA11G36980.40.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.36e-62squamosa promoter binding protein-like 2