PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G216500.1.p
Common NameGLYMA_11G216500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 596aa    MW: 64978 Da    PI: 4.7892
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G216500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.27.9e-1392185831374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          lv++Ll+cAeav++++l+la+al++++  la++++ +m+++a+yf++ALa+r+++        + p+et +++ s++l++   f+e +P+
  Glyma.11G216500.1.p 218 LVHTLLACAEAVQQENLKLADALVKHVGILAASQAGAMRKVASYFAQALARRIYG--------IFPEETLDSSFSDVLHM--HFYESCPY 297
                          689****************************************************........44455544566677666..5******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lkf+h+taNqaIlea++++ +vH+iDf+++qG+QWpaL+qaLa Rp+gpp++R+Tg+g+p+++++++l+++g +La++A+ +gv+fef+ 
  Glyma.11G216500.1.p 298 LKFAHFTANQAILEAFATAGKVHVIDFGLKQGMQWPALMQALALRPGGPPTFRLTGIGPPQPDNTDALQQVGLKLAQLAQIIGVQFEFRG 387
                          ****************************************************************************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                          +v+++l+dl++++L+++pgEa+aVn+v++lhr+l++s+s+++    vL++vk+++P++v++veqea+hn++ Fl+rf+eal+yys+lfds
  Glyma.11G216500.1.p 388 FVCNSLADLDPNMLEIRPGEAVAVNSVFELHRMLARSGSVDK----VLDTVKKINPQIVTIVEQEANHNGPGFLDRFTEALHYYSSLFDS 473
                          **********************************99999999....******************************************** PP

                 GRAS 271 leaklpres.....eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveee 354
                          le + ++ +     +++  +++ +lgr+i+nvva eg +r+erhetl +Wr rl++aGF pv+l+++a kqa++ll+ ++ +dgyrvee+
  Glyma.11G216500.1.p 474 LEGSSSSSTglgspSQDLLMSELYLGRQICNVVAYEGPDRVERHETLTQWRGRLDSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEEN 563
                          *8885555567778999************************************************************************* PP

                 GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                          +g+l+lgW++rpL+++SaW+
  Glyma.11G216500.1.p 564 NGCLMLGWHTRPLIATSAWK 583
                          *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011294.2E-3655128No hitNo description
PfamPF120411.1E-3755122IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098568.749192562IPR005202Transcription factor GRAS
PfamPF035142.7E-136218583IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MKRDHKDSCG GGGAAGGTVK GECSSMQSNG KAKMWEEEQQ QQQQQQQQQQ QQGMDELLAA  60
LGYKVRASDM ADVAQKLEQL EMVMGCAQED GISHLASDTV HYDPTDLYSW VQSMLTELNP  120
EPNNNLDPSS FLIDNNNNII NSTAPVFNDD SEYDLRAIPG IAAYPPPLPQ DNHLDEIETA  180
NNINKRLKPS PAESADSAAS EPTRHVVLVD HQEAGVRLVH TLLACAEAVQ QENLKLADAL  240
VKHVGILAAS QAGAMRKVAS YFAQALARRI YGIFPEETLD SSFSDVLHMH FYESCPYLKF  300
AHFTANQAIL EAFATAGKVH VIDFGLKQGM QWPALMQALA LRPGGPPTFR LTGIGPPQPD  360
NTDALQQVGL KLAQLAQIIG VQFEFRGFVC NSLADLDPNM LEIRPGEAVA VNSVFELHRM  420
LARSGSVDKV LDTVKKINPQ IVTIVEQEAN HNGPGFLDRF TEALHYYSSL FDSLEGSSSS  480
STGLGSPSQD LLMSELYLGR QICNVVAYEG PDRVERHETL TQWRGRLDSA GFDPVHLGSN  540
AFKQASMLLA LFAGGDGYRV EENNGCLMLG WHTRPLIATS AWKLPSSSES SGLTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-642185834375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.151270.0epicotyl| pod| root| seed coat| vegetative bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8574080.0EU857408.1 Glycine max gibberellic acid-insensitive mutant protein (GAI) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538395.10.0PREDICTED: DELLA protein GAI
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLI1LMC80.0I1LMC8_SOYBN; Uncharacterized protein
STRINGGLYMA11G33720.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Bassel GW,Zielinska E,Mullen RT,Bewley JD
    Down-regulation of DELLA genes is not essential for germination of tomato, soybean, and Arabidopsis seeds.
    Plant Physiol., 2004. 136(1): p. 2782-9
    [PMID:15347801]