PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G210800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WOX
Protein Properties Length: 401aa    MW: 43763.1 Da    PI: 8.6886
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G210800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.1e-1857117257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Glyma.11G210800.1.p  57 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 117
                          89*****************99*************************************995 PP

2Wus_type_Homeobox112.12.9e-3656118264
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
  Glyma.11G210800.1.p  56 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 118
                          689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-742116IPR009057Homeodomain-like
SuperFamilySSF466894.71E-1253121IPR009057Homeodomain-like
PROSITE profilePS5007110.51153118IPR001356Homeobox domain
SMARTSM003896.8E-955122IPR001356Homeobox domain
CDDcd000861.67E-856118No hitNo description
PfamPF000462.1E-1557117IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNPH HQWQHDINSS LISTSCHRSP YSSGGGGGCE ERSPEPKPRW  60
NPKPEQIRIL EAIFNSGMVN PPRDEIRKIR AQLQEYGQVG DANVFYWFQN RKSRSKHKLR  120
HLQNSSSKNL NHHHHLVDQN HHTPTSLPQT ATTAPSSSSS SSSEKSSPKE LIIPTTKVFS  180
IGFSDVMPNS PTASVNQTYF QTRINESIML PSPPPPVEAF FFPVQQQHHG VTSSSQGFCF  240
SELSNVVHQH NSVGPCTSLL LSEIVGHGVA SASASKKDKS QVKIMHQPSL LNFCVTTPTT  300
TAPSTTTTVV VPPITTTSST TVPSPLMHQL QGIGDPGGAA RSMVFINDVA FEVALGPFNV  360
REAFGDDAVL IHASTGQPVL TNQWGLTLHS LQHGACYYLI *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G210800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0957160.0BT095716.1 Soybean clone JCVI-FLGm-25E14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594207.10.0WUSCHEL-related homeobox 9
TrEMBLA0A445HGE80.0A0A445HGE8_GLYSO; WUSCHEL-related homeobox 9 isoform A
STRINGGLYMA13G21860.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Representative plantOGRP61031220
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-62homeobox-3