PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G186400.1.p
Common NameGLYMA_11G186400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 151aa    MW: 17596.8 Da    PI: 11.0223
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G186400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF34.72.3e-111151343
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         i n+  r  t+ kR++ +lKK eEL +L ++e++ i+++++
  Glyma.11G186400.1.p 11 ITNDAARRETYKKRKKQMLKKVEELNTLYGIEACAIVYGHN 51
                         889999*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.573151IPR002100Transcription factor, MADS-box
SMARTSM004327.6E-8162IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-15298IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-5323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-121151IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MTRKKVKLTL ITNDAARRET YKKRKKQMLK KVEELNTLYG IEACAIVYGH NDLDRARVLA  60
IPLGEWGVQR VVEKLRIMPE LERSKKMVNQ AGFIGQRILK GNEQVMKLMK DNREKDQSPI  120
LSLLNTTKKR IFLRRWNSTI NKFTTNNHIC *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLTLITNDAARRETYKKRK
22125KKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G186400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006591731.19e-94agamous-like MADS-box protein AGL80
TrEMBLI1LLX21e-106I1LLX2_SOYBN; Uncharacterized protein
STRINGGLYMA11G30690.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-26AGAMOUS-like 80