PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G164800.1.p
Common NameGLYMA_11G164800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 173aa    MW: 19340.1 Da    PI: 7.3024
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G164800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.61.2e-4461051100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrr+C+kdC++apyfp+++p+kf +vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql
  Glyma.11G164800.1.p   6 PCASCKLLRRRCSKDCIFAPYFPSDDPRKFSIVHKVFGASNISKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQL 95 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +la++++e
  Glyma.11G164800.1.p  96 QMQLAVAQTE 105
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8895106IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGGTSPCASC KLLRRRCSKD CIFAPYFPSD DPRKFSIVHK VFGASNISKM LQELPIHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQTEILCIQ MQQQEPTLAT  120
QLVDQDDKSM LLSVNNNYEM LPQFLKFPSS SSSSSNVFQD PHEPLKRESF WT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-114AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537315.21e-127PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW38e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLI1LLS01e-127I1LLS0_SOYBN; Uncharacterized protein
STRINGGLYMA11G29450.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-77LBD family protein