PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G156200.1.p
Common NameGLYMA_11G156200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 157aa    MW: 17612.7 Da    PI: 8.7815
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G156200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.81.3e-1776110135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C+nC tt  plWR+gp g+k+LCnaCG++++k+++
  Glyma.11G156200.1.p  76 CANCDTTYNPLWRNGPHGPKSLCNACGIRFKKEER 110
                          ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.1E-1370128IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-1274112No hitNo description
Gene3DG3DSA:3.30.50.104.9E-1575110IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.58575106IPR000679Zinc finger, GATA-type
CDDcd002023.05E-1175107No hitNo description
PfamPF003201.2E-1576110IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MTLITPSSSS SVDCTLSLGT PSTRFSKYEE KRSCHERRSV SNFCWDLLQS KHNNPQSHSK  60
SSQITNTTDP VLVHRCANCD TTYNPLWRNG PHGPKSLCNA CGIRFKKEER RASAATAKMQ  120
CFSPRMGNEF RFMDDADRVT ADNGISFLSW RLNVTD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006590690.15e-74PREDICTED: GATA transcription factor 18-like
SwissprotQ8LC799e-38GAT18_ARATH; GATA transcription factor 18
TrEMBLK7LQQ61e-115K7LQQ6_SOYBN; Uncharacterized protein
STRINGGLYMA11G25375.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41053459
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50870.11e-37GATA family protein