PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G156200.1.p
Common NameGLYMA_11G156200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 157aa    MW: 17612.7 Da    PI: 8.7815
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G156200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.81.3e-1776110135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C+nC tt  plWR+gp g+k+LCnaCG++++k+++
  Glyma.11G156200.1.p  76 CANCDTTYNPLWRNGPHGPKSLCNACGIRFKKEER 110
                          ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.1E-1370128IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-1274112No hitNo description
Gene3DG3DSA:3.30.50.104.9E-1575110IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.58575106IPR000679Zinc finger, GATA-type
CDDcd002023.05E-1175107No hitNo description
PfamPF003201.2E-1576110IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MTLITPSSSS SVDCTLSLGT PSTRFSKYEE KRSCHERRSV SNFCWDLLQS KHNNPQSHSK  60
SSQITNTTDP VLVHRCANCD TTYNPLWRNG PHGPKSLCNA CGIRFKKEER RASAATAKMQ  120
CFSPRMGNEF RFMDDADRVT ADNGISFLSW RLNVTD*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In the developing axillary shoot apical meristem (SAM), expressed at the boundary between nascent axillary meristems and the adaxial side of leaves. In all mature SAMs, located at the boundaries between the central SAM and the initiating organ primordia, as well as between the neighboring initiating organ primordia. In the floral meristem, strongly expressed at the boundaries between the meristematic dome and the initiating floral organ primordia, and also at the boundaries between the primordia of different whorls. Expression at the boundaries attenuates as the organ primordia grow apart. In flowers, localized at the boundary between the central meristematic cells and differentiating stamen primordia to later accumulates at the medial ridge region of the carpel. Highly expressed in the developing anthers, in both the tapetum cell layer and microsporocytes. In developing ovules, confined to inner and outer integuments. In aerial tissues, strongly present in phloem tissues (PubMed:15367721). First observed in the whole embryo, but later confined to the center cells of the embryo and provascular tissues (PubMed:15367721, PubMed:20643354). {ECO:0000269|PubMed:15367721, ECO:0000269|PubMed:20643354}.
UniprotTISSUE SPECIFICITY: Expressed in vegetative and inflorescence shoot apical meristems (SAMs), axillary (SAMs), floral meristems, developing ovules and stamens, vascular tissues, and in the embryo. {ECO:0000269|PubMed:15367721, ECO:0000269|PubMed:26390296}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional factor that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters (including its own promoter and GATA21 promoter), thus regulating the expression of genes mostly involved in hormone responses and floral organ specification (including genes regulating hormones responses) (PubMed:23335616, PubMed:26390296). Regulates both flower and shoot apical meristem (SAM) development, especially for establishing organ boundaries in shoots and flowers, probably by controlling the number and position of WUS-expressing cells (PubMed:15367721, PubMed:23335616). Coregulates, with AGO10/PNH, the shoot apical meristem (SAM) organization. Regulates floral organ development via the promotion of JAG and NPR5/BOP2 expression. Modulates cytokinin homeostasis in organ boundaries by regulating CKX3 expression (PubMed:26390296). Involved in cell proliferation and differentiation (PubMed:15367721). Required to position the inductive proembryo boundary via the regulation of gene expression and for early embryonic development (PubMed:20643354). Together with GIF1/AN3, mediates cotyledon identity by preventing ectopic root formation through the repression of PLT1 expression (PubMed:22669825). {ECO:0000269|PubMed:15367721, ECO:0000269|PubMed:20643354, ECO:0000269|PubMed:22669825, ECO:0000269|PubMed:23335616, ECO:0000269|PubMed:26390296}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G156200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed via a negative regulatory feedback loop. {ECO:0000269|PubMed:23335616}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028242334.11e-77GATA transcription factor 18-like
SwissprotQ8LC791e-36GAT18_ARATH; GATA transcription factor 18
TrEMBLK7LQQ61e-113K7LQQ6_SOYBN; Uncharacterized protein
STRINGGLYMA11G25375.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41053459
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50870.11e-37GATA family protein
Publications ? help Back to Top
  1. Behringer C,Bastakis E,Ranftl QL,Mayer KF,Schwechheimer C
    Functional diversification within the family of B-GATA transcription factors through the leucine-leucine-methionine domain.
    Plant Physiol., 2014. 166(1): p. 293-305
    [PMID:25077795]