PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G140200.1.p
Common NameGLYMA_11G140200, LOC100801154
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 336aa    MW: 36560.3 Da    PI: 9.4
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G140200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-3970130262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          +e+alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nkk++
  Glyma.11G140200.1.p  70 PEAALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKNK 130
                          57889*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3354123IPR003851Zinc finger, Dof-type
PfamPF027017.0E-3373128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.66574128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVFSSIPVFV DPPNWQQQPN NHPQANNNGG DNTQLLPPLP PHQSHVGGSV GSIRPGSMAD  60
RARLAKLPPP EAALKCPRCD STNTKFCYFN NYSLSQPRHF CKTCRRYWTR GGALRNVPVG  120
GGCRRNKKNK RSSRSKSPAS SEKQQTLSGS TSAIVPSGGT THEQIGHQLP QPQNLPFLAS  180
LQNLNRYAVG NMGLGLREIH GQNENMGFQI GNSSAGGGMD QWRLHQQVPF FNGFESTSAG  240
SYPFQNEGIN ETPSGFGGDI TTNSRVSQMP SVKMEESGAL NLSRSTLNNV LQKITSTIHG  300
LICQVLLLFL LLISCNFEHI TCMWSITTSP ELLCP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.215440.0meristem| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G140200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352950.0AC235295.1 Glycine max strain Williams 82 clone GM_WBb0059N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006590988.20.0dof zinc finger protein DOF3.6
TrEMBLA0A0R0HGZ10.0A0A0R0HGZ1_SOYBN; Uncharacterized protein
STRINGGLYMA11G14920.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.15e-48OBF-binding protein 3