PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G138300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 632aa    MW: 72173.4 Da    PI: 6.2999
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G138300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS372.65.3e-1142546281373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl c + v ++d++ a++lL+++++++sp gd+ qRla+yf+++L+arl++ +++     +  ++++ + +e l+ ++ f  +sP+
  Glyma.11G138300.1.p 254 LRNLLLMCSQSVYANDNRTANELLKQIRQHSSPVGDASQRLAHYFANGLEARLVGDGTSSQGMYTFLSSKNITAAEFLKTHQDFMSASPF 343
                          6899**************************************************94444433334444444449999999999******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           kf+++ aN++I++a+++ e+vHiiDf+i +G+QWp L++ L++R++gpp+lRiTg++ p++g   +e++ etg+rLa+++++  vpfe+
  Glyma.11G138300.1.p 344 KKFTYFFANKMIMKAAAKVETVHIIDFGILYGFQWPILIKFLSNREGGPPKLRITGIEFPQPGfrPTEKIDETGRRLANYCKRYSVPFEY 433
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n++++k++e++++e+L+++++E +aVn++ + ++lld+s +++s+r++vL+l+++++P++++ +  + ++n++ F+ rf eal +ysa++
  Glyma.11G138300.1.p 434 NAIASKNWETIRIEALKIESNELVAVNCHQRFENLLDDSIEVNSPRNAVLHLIRKINPNIFTQSITNGSYNAPFFAPRFREALFHYSAIY 523
                          ***99************************************************************************************* PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d +++ ++re+e r ++Erellgrei+nv+aceg+er+er et+++W+ r ++aGFk++pl+e+ +++ ++ lrk + + +  +e+s+++
  Glyma.11G138300.1.p 524 DLIDTIIHRENERRLMIERELLGREIMNVIACEGSERIERPETYKQWQVRNMKAGFKQLPLDEELMAKFRTELRKWYHRDFVSDEDSNWM 613
                          *****************************************************************************999********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          +lgWk+r L++ ++W
  Glyma.11G138300.1.p 614 LLGWKGRILFASTCW 628
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.602228609IPR005202Transcription factor GRAS
PfamPF035141.8E-111254628IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MEDNDFSETA KFISQILMEE NVELEQSPFY DSLTLQVTEK SFYDALAGNL LLSPQASNTN  60
FSVENSRELN LPSPDSLSVS ALQFNPHALS QPPPLVNVSE GVSDLDSSIA RLLAHNIFND  120
VDSVSHFRRG FEEASRFLPP GPNLVTALHS NAQEPINSFR ENSYGLLKGR KNLERQEINT  180
REEERGGRSN KQSAFSFVDE SDLSDAIDRV FLSVENVCSE HSSLQSGPLR AEEQDRGKGL  240
SKKQERRKQE TVDLRNLLLM CSQSVYANDN RTANELLKQI RQHSSPVGDA SQRLAHYFAN  300
GLEARLVGDG TSSQGMYTFL SSKNITAAEF LKTHQDFMSA SPFKKFTYFF ANKMIMKAAA  360
KVETVHIIDF GILYGFQWPI LIKFLSNREG GPPKLRITGI EFPQPGFRPT EKIDETGRRL  420
ANYCKRYSVP FEYNAIASKN WETIRIEALK IESNELVAVN CHQRFENLLD DSIEVNSPRN  480
AVLHLIRKIN PNIFTQSITN GSYNAPFFAP RFREALFHYS AIYDLIDTII HRENERRLMI  540
ERELLGREIM NVIACEGSER IERPETYKQW QVRNMKAGFK QLPLDEELMA KFRTELRKWY  600
HRDFVSDEDS NWMLLGWKGR ILFASTCWVP A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-452586288374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.44170.0hypocotyl| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539081.20.0PREDICTED: scarecrow-like protein 34
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLI1LK080.0I1LK08_SOYBN; Uncharacterized protein
STRINGGLYMA11G14710.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14