PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G138200.1.p
Common NameGLYMA_11G138200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 169aa    MW: 18975.8 Da    PI: 9.3186
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G138200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS33.46e-1162108293339
                 GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                          +++n++aceg+er+er et+++W+ r ++aGFk + l+e+++++ ++
  Glyma.11G138200.1.p  62 NVMNAIACEGSERIERPETYKQWQVRNTRAGFKRLLLNEETMAKFRT 108
                          799************************************99988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.6351123IPR005202Transcription factor GRAS
PfamPF035142.1E-862108IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MEPSLRDPSL EDNDFSETSK FISQILMEEN KSFYQALTEN IPIFPNQHPL LLLTPIGETT  60
SNVMNAIACE GSERIERPET YKQWQVRNTR AGFKRLLLNE ETMAKFRTGI RTGCFKVGRA  120
TFCTLPLVGR CYQTLFRAHT RLKGSILLSI IRSSNLGFGG AIKVGREG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.217513e-38leaf
Gma.44173e-38hypocotyl| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539082.12e-19PREDICTED: scarecrow-like protein 14
TrEMBLK7LPM81e-122K7LPM8_SOYBN; Uncharacterized protein
STRINGGLYMA11G14690.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14801813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.15e-15GRAS family protein