PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G138100.1.p
Common NameGLYMA_11G138100, LOC100794790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 615aa    MW: 70234.4 Da    PI: 6.3783
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G138100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.51.1e-1132376111373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl c + v ++d + a++lL+++++++sp gd+ qRla+yf+++L+arl + +s+   +++  ++++ + +e l+a+++f  ++P+
  Glyma.11G138100.1.p 237 LRNLLLMCSQSVYANDIRTANELLKQIRQHSSPVGDASQRLAHYFANGLEARLIGAGSGAIGTFSFVSSKRITAAEFLKAYQVFLSATPF 326
                          6899************************************************************************************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           kf+++ aNq+I++a++++e +HiiD++i +G+QWp L++ L++R++gpp+lRiTg++ p+sg   +e++eetg+rLa+++++ +vpfe+
  Glyma.11G138100.1.p 327 KKFTYFFANQMIVKAAAKAEIIHIIDYGILYGFQWPILIKFLSNREGGPPKLRITGIEFPQSGfrPTERIEETGHRLANYCKRYNVPFEY 416
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesv.sleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          ++++++++e+++le+L+++++E +aVn++++ ++lldes+ +++s+r+++L+l+++++P++++ +  + +++++ F++rf eal +ysa+
  Glyma.11G138100.1.p 417 HAIASRNWETIKLEALKIERNELVAVNCHMRFEHLLDESTiEVNSPRNAFLHLIRKINPDIFTQIIINGSYDAPFFATRFREALFHYSAI 506
                          **9999******************************997625666********************************************* PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          +d++++ + +e+e+r+++E ellgre++nv+aceg+er++r et+++W+ r ++aGFk++pl+e+ +++ ++ l++++ d + ++e++++
  Glyma.11G138100.1.p 507 YDMFDTVITSENEWRMTIESELLGREVMNVIACEGSERVQRPETYKQWQVRNTRAGFKQLPLNEELMAKFRSKLKEYHRD-FVLDENNNW 595
                          ******************************************************************************66.********* PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          +++gWk+r   + ++W
  Glyma.11G138100.1.p 596 MLQGWKGRIFNASTCW 611
                          **********999999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.412211593IPR005202Transcription factor GRAS
PfamPF035143.8E-111237611IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MEPNIPRGAE EQSTAYLMED SDFSETAKFI SQILMEENID QRPLYDTLTL QVTEKSFYDA  60
LTGNIPLSPN PNQHPLLLSP QAQTTITEHG LSDLDSSLQQ NLFNDADSVS HFKRGLEEAT  120
KFLPPVSNLV TGQYPNGEQP INTFEGNSYG FQSRKNHERE EIDTREEEHE GRGHKQSALS  180
LVDETDLSDA IDRVFLSVEN VCIEHSSLQN GALKPKAPEV GKGRSKKQGR KKETVDLRNL  240
LLMCSQSVYA NDIRTANELL KQIRQHSSPV GDASQRLAHY FANGLEARLI GAGSGAIGTF  300
SFVSSKRITA AEFLKAYQVF LSATPFKKFT YFFANQMIVK AAAKAEIIHI IDYGILYGFQ  360
WPILIKFLSN REGGPPKLRI TGIEFPQSGF RPTERIEETG HRLANYCKRY NVPFEYHAIA  420
SRNWETIKLE ALKIERNELV AVNCHMRFEH LLDESTIEVN SPRNAFLHLI RKINPDIFTQ  480
IIINGSYDAP FFATRFREAL FHYSAIYDMF DTVITSENEW RMTIESELLG REVMNVIACE  540
GSERVQRPET YKQWQVRNTR AGFKQLPLNE ELMAKFRSKL KEYHRDFVLD ENNNWMLQGW  600
KGRIFNASTC WFPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-442415698329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539080.10.0PREDICTED: scarecrow-like protein 31
RefseqXP_014619523.10.0PREDICTED: scarecrow-like protein 31
RefseqXP_014619524.10.0PREDICTED: scarecrow-like protein 31
SwissprotQ3EDH00.0SCL31_ARATH; Scarecrow-like protein 31
TrEMBLI1LK070.0I1LK07_SOYBN; Uncharacterized protein
STRINGGLYMA11G14700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07520.11e-174GRAS family protein