PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G127400.1.p
Common NameGLYMA_11G127400, LOC100780613
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 296aa    MW: 33113 Da    PI: 5.1687
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G127400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR193.13.6e-29120207291
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                          fYn+YA+evGF vr+sk ++s+r+g+ + rt+vC+keg+r  +k++  k  r+raetr+gC+a+++v+k ++gkw+v+k+++eH+H+l+p
  Glyma.11G127400.1.p 120 FYNAYATEVGFIVRVSKLSRSRRDGTAIGRTLVCNKEGFRMADKRE--KIVRQRAETRVGCRAMIMVRKLSSGKWVVAKFVKEHTHPLTP 207
                          ******************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.2E-26120207IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MNQLFINFID CCVELEYHLC TENLIPDSFV TAVEVEIDGS VTVETVGNTA IGEVSSIADD  60
NREGGSSVEP NDNQDQHDNG TQDSSGGITI PSAIPTVSVV SVEEPYVGQE FGSEAAAHAF  120
YNAYATEVGF IVRVSKLSRS RRDGTAIGRT LVCNKEGFRM ADKREKIVRQ RAETRVGCRA  180
MIMVRKLSSG KWVVAKFVKE HTHPLTPGKG RRDFYYEQYP TEQDKIRELS QQLATEKKRS  240
AAYKRHLELI FEQIEEQNDN LSKKIQHIVD CVKEMEAKEE HSRQCEGDGS QRTTE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.130980.0leaf| somatic embryo| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0944940.0BT094494.1 Soybean clone JCVI-FLGm-18B16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014619497.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6 isoform X1
TrEMBLI1LJP50.0I1LJP5_SOYBN; Uncharacterized protein
STRINGGLYMA11G13610.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10299610
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.26e-88FAR1 family protein