PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G111700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 300aa    MW: 33484.4 Da    PI: 6.402
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G111700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.5e-18216249134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  Glyma.11G111700.1.p 216 CSHCQVQKTPQWRIGPLGPKTLCNACGVRFKSGR 249
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.6E-771297IPR016679Transcription factor, GATA, plant
SMARTSM004014.1E-13210260IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.108210246IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.6E-14214247IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577164.75E-13214274No hitNo description
CDDcd002021.90E-13215272No hitNo description
PfamPF003202.9E-16216249IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MEVAAAKALK PSLRTEFIFP QAIYDEILCF NANNVVADED FSMDDLLDFS NGEFQVGKDF  60
DDYEEEEDEE KNSTSGSLQS QDRAEDDNNS NSTAGGGGHD YVFAGELSVP ADDVADLEWV  120
SHFVDDSLPE LSILYPIHCS KKTRVWAEPE SRLSPAQTVS KVPRKSRTEK PRKPNTRVWS  180
SFTVFAGSVG FGELVTKKQK KKVEAQSGGA QSLRRCSHCQ VQKTPQWRIG PLGPKTLCNA  240
CGVRFKSGRL FPEYRPACSP TFCGHIHSNN HRRVLEMRWK KQIAESVTGS DRKQLIPNY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352640.0AC235264.1 Glycine max strain Williams 82 clone GM_WBb0041H18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539005.10.0PREDICTED: GATA transcription factor 7-like
RefseqXP_014619472.10.0PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0B2S3K00.0A0A0B2S3K0_GLYSO; GATA transcription factor 7 (Fragment)
STRINGGLYMA11G11930.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.15e-52GATA transcription factor 7