PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G108100.1.p
Common NameGLYMA_11G108100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bZIP
Protein Properties Length: 271aa    MW: 29315.8 Da    PI: 6.5755
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G108100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1279.8e-0987137151
                          XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          ek++   +r   N+eA r++R++Kka+ + Le++v +L a N+ L k+l+ 
  Glyma.11G108100.1.p  87 EKKSSSKKRPLGNKEAVRKYREKKKARAASLEDEVVKLRALNQHLMKKLQG 137
                          567777899999***********************************9974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.0E-1385155No hitNo description
SMARTSM003385.6E-987154IPR004827Basic-leucine zipper domain
PfamPF077165.7E-1290144IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-694137No hitNo description
CDDcd146863.99E-1195146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDDGELDFSN HEVFSSPNMG ELPSSGSMDS FFDELLKDTH ACTHTHTCNP PGPDFSHTHT  60
CYHVHTKIVP APEEDQVATD DTAESAEKKS SSKKRPLGNK EAVRKYREKK KARAASLEDE  120
VVKLRALNQH LMKKLQGQAA LEAEIARLKC LLVDIRGRIE GEIGSFPYQK TTTTTPNPVA  180
GSYVMNPCNL PCDDRVYCLH PDGRIGETAA LNGEEFDGCE FENLQCLASQ NLGLKDLRAC  240
GVGVGHTGSN VNSSALSKKR KGGSRAATAG *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.71030.0pod| root| seed coat| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G108100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2354190.0AC235419.1 Glycine max strain Williams 82 clone GM_WBb0136G05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237296.20.0bZIP transcription factor bZIP121
RefseqXP_006590381.10.0bZIP transcription factor bZIP121 isoform X1
RefseqXP_006590382.10.0bZIP transcription factor bZIP121 isoform X1
RefseqXP_014619019.10.0bZIP transcription factor bZIP121 isoform X1
RefseqXP_014619020.10.0bZIP transcription factor bZIP121 isoform X1
RefseqXP_028190347.10.0basic leucine zipper 23-like
RefseqXP_028190348.10.0basic leucine zipper 23-like
RefseqXP_028190350.10.0basic leucine zipper 23-like
RefseqXP_028190351.10.0basic leucine zipper 23-like
RefseqXP_028190352.10.0basic leucine zipper 23-like
SwissprotQ8GTS21e-109BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A445HZT30.0A0A445HZT3_GLYSO; Basic leucine zipper 23 isoform A
TrEMBLI1LJ220.0I1LJ22_SOYBN; Uncharacterized protein
STRINGGLYMA11G11540.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.15e-94bZIP family protein
Publications ? help Back to Top
  1. Liao Y, et al.
    Soybean GmbZIP44, GmbZIP62 and GmbZIP78 genes function as negative regulator of ABA signaling and confer salt and freezing tolerance in transgenic Arabidopsis.
    Planta, 2008. 228(2): p. 225-40
    [PMID:18365246]
  2. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  3. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  4. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]