PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G096000.2.p
Common NameGLYMA_11G096000, LOC100814131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 456aa    MW: 51454.3 Da    PI: 5.8229
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G096000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.28.3e-139284521374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl+cA++v++g+le+a+++L+++s laspdgd+mqR+a+yf+e La r++++++++ +al++++ +    s+e+ ++klf+e++P+
  Glyma.11G096000.2.p  28 LIHLLLTCANHVAAGNLENANTTLEQISLLASPDGDTMQRIATYFMESLADRILKTWPGIHRALNSTRIT--LLSDEILVQKLFFELFPF 115
                          689*************************************************************999987..7***************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lk++++++NqaI ea+ege+ +HiiD+++ + +QW+aLlq L+ Rpegpp+lRiTgv++    +ke l ++++rL++ Ae+l++pf+fn+
  Glyma.11G096000.2.p 116 LKVAFVLTNQAIIEAMEGEKVIHIIDLNAAEAAQWIALLQVLSGRPEGPPHLRITGVHQ----KKEILDQVAHRLTEEAEKLDIPFQFNP 201
                          ***********************************************************....9************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrll........................................................ 214
                           v+++le+l++++Lrvk+gEala++++lqlh+ll                                                        
  Glyma.11G096000.2.p 202 -VVSKLENLDFDKLRVKTGEALAISSILQLHTLLawddetmqrksplllktsngihlqrvlpmgqstlgdlvekdmvngytlspdstsss 290
                          .799************************************************************************************99 PP

                 GRAS 215 ......desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                                ++s+    + +++L+++++lsPkv+vv+eq+++hn++++++r+leal+ ++alfd+le++++r+s er  vE++l+g+ei+n++
  Glyma.11G096000.2.p 291 paslttSNSM----NMESFLNALWGLSPKVMVVTEQDCNHNGPTLMDRLLEALYSFAALFDCLESTVSRTSLERLRVEKMLFGEEIKNII 376
                          8755322222....5578************************************************************************ PP

                 GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          aceg+er+erhe+lekW +r++ aGF++vpls++ + qa++ l+ ++ +gyr+ +e+g+++++W+drp++s+SaWr
  Glyma.11G096000.2.p 377 ACEGSERKERHEKLEKWFQRFDLAGFGNVPLSYFGMLQARRFLQSYGCEGYRMRDENGCVLICWEDRPMYSISAWR 452
                          ***************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.7722432IPR005202Transcription factor GRAS
PfamPF035142.8E-13628452IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MMSLSPSLGS PNNLLFREMK SEERGLYLIH LLLTCANHVA AGNLENANTT LEQISLLASP  60
DGDTMQRIAT YFMESLADRI LKTWPGIHRA LNSTRITLLS DEILVQKLFF ELFPFLKVAF  120
VLTNQAIIEA MEGEKVIHII DLNAAEAAQW IALLQVLSGR PEGPPHLRIT GVHQKKEILD  180
QVAHRLTEEA EKLDIPFQFN PVVSKLENLD FDKLRVKTGE ALAISSILQL HTLLAWDDET  240
MQRKSPLLLK TSNGIHLQRV LPMGQSTLGD LVEKDMVNGY TLSPDSTSSS PASLTTSNSM  300
NMESFLNALW GLSPKVMVVT EQDCNHNGPT LMDRLLEALY SFAALFDCLE STVSRTSLER  360
LRVEKMLFGE EIKNIIACEG SERKERHEKL EKWFQRFDLA GFGNVPLSYF GMLQARRFLQ  420
SYGCEGYRMR DENGCVLICW EDRPMYSISA WRSRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-41284524375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537745.10.0PREDICTED: scarecrow-like protein 3 isoform X1
RefseqXP_006590776.10.0PREDICTED: scarecrow-like protein 3 isoform X2
RefseqXP_006590777.10.0PREDICTED: scarecrow-like protein 3 isoform X2
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLI1LIM70.0I1LIM7_SOYBN; Uncharacterized protein
STRINGGLYMA11G10170.30.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3