PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G083900.1.p
Common NameGLYMA_11G083900, LOC100820357
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 147aa    MW: 16298.2 Da    PI: 8.5084
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G083900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1253e-3956131277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          Cq+++C ++ls ak+y+rrhkvCe h+kapvvlvs ++qrfCqqCs+fhel efD++krsCr+ La+hnerrrk++
  Glyma.11G083900.1.p  56 CQADECGVNLSMAKSYNRRHKVCERHAKAPVVLVSSIRQRFCQQCSKFHELAEFDDTKRSCRKTLAGHNERRRKAR 131
                          *************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-3049117IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.30853130IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.98E-3655134IPR004333Transcription factor, SBP-box
PfamPF031101.6E-3156129IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MAKTPSEEER EMDNGNDEEG GEGEVGAKMV QNIKIKLVCG KDSGSRTASS SSHSFCQADE  60
CGVNLSMAKS YNRRHKVCER HAKAPVVLVS SIRQRFCQQC SKFHELAEFD DTKRSCRKTL  120
AGHNERRRKA RIDVSLGGGE QHQSHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3147129284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G083900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150434e-56AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538904.11e-105squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_028187540.11e-105squamosa promoter-binding-like protein 3
SwissprotQ6Z4616e-36SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A445HYY11e-103A0A445HYY1_GLYSO; Squamosa promoter-binding-like protein 13
TrEMBLK7LNN21e-103K7LNN2_SOYBN; Uncharacterized protein
STRINGGLYMA11G08905.11e-104(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.15e-35squamosa promoter binding protein-like 5