PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G059300.1.p
Common NameGLYMA_11G059300, LOC100800420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 340aa    MW: 36176.1 Da    PI: 8.7961
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G059300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-3963122261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk+k+s
  Glyma.11G059300.1.p  63 ENQNLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKSKSS 122
                          57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.2E-3265121IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2167112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.43267121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MIQEMLGGAS ASHIPGERKI SINNGGGGRA LLLTPPTSSS SPSCTTSITT STATATATSS  60
NSENQNLRCP RCDSSNTKFC YYNNYNLTQP RHFCKTCRRY WTKGGALRNV PIGGGCRKSK  120
SSGGMSNSVA KQTATKMKAV ASELGRSPQG LFDQELPQTP ILWGSPQNSQ LMALLRATQN  180
QNPNPNPSPM SISVKGEGNL MGSHSHMVST ESLLANGLLN PRTSLGFDDG RVGEALPSLG  240
LCSSFWRNNQ DQTQQQNNGF VVGEHQSSGV QELYHKLRSS SSVNYWGSDN SPVFLSNMAS  300
SSSSLSNILE SSSVSGSEFG CWNPTLSWSD LPTTNGAYP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286740.0pod| root| seed coat| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G059300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0958240.0BT095824.1 Soybean clone JCVI-FLGm-19N22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537372.10.0dof zinc finger protein DOF5.3
RefseqXP_028186832.10.0dof zinc finger protein DOF5.3-like
TrEMBLA0A445HXS00.0A0A445HXS0_GLYSO; Dof zinc finger protein DOF5.7
TrEMBLI1LHH90.0I1LHH9_SOYBN; Uncharacterized protein
STRINGGLYMA11G06300.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-28DOF zinc finger protein 1