PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G047700.1.p
Common NameGLYMA_11G047700, LOC100797072
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 483aa    MW: 54540.1 Da    PI: 5.4679
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G047700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS351.81.1e-1071074793374
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          + Lle A+av+++++++ q+l++ l+el+sp+gd+ q+la+yf++A  +r+++ ++++yk+l++ ++++ + +++ + +  f+e+sP+ +
  Glyma.11G047700.1.p 107 DILLETARAVADKNTTRLQQLMWMLNELSSPYGDTDQKLASYFLQAFFSRITQAGDRTYKTLASASEKTCSFESTRKTVLKFQELSPWTT 196
                          689***********************************************************8887775554444455555********* PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                          f+h++ N aIlea+ege ++Hi+D++ ++++QWp+L++aLa+R++++p+lR+T v+ + ++ ++ ++e+g r++kfA+ +gvpf+fnv++
  Glyma.11G047700.1.p 197 FGHVASNGAILEALEGEPKLHIVDISNTYCTQWPTLFEALATRNDDTPHLRLTSVVTAGATAQKVMKEIGARMEKFARLMGVPFKFNVVH 286
                          *********************************************************9999***************************96 PP

                 GRAS 183 ak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sFlerflealeyysal 267
                          +  +l+dl+++ L++k++Eala+n+v  lh++     ++ ++rd+v++ +++l+P++v+vve+ead++ +    +F+++f e+l+++ + 
  Glyma.11G047700.1.p 287 HVgQLSDLDFSVLDIKEDEALAINCVNTLHSIA----AVGNHRDAVISSLRRLKPRIVTVVEEEADLDIGlegfEFVKGFEECLRWFRVY 372
                          656*****************************8....888899*********************99855555669*************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee.aGFkpvplsekaakqaklllrkvksdg.yrveees 355
                          f++l++++pr+s+er ++Er+  gr++v++vac+ a+++er+e++++W +r++   GF++v++se++ +++++llr++  +g  + ++++
  Glyma.11G047700.1.p 373 FEALDESFPRTSNERLMLERA-AGRAVVDLVACSPADSVERREKAARWARRMHGgGGFNTVAFSEEVCDDVRALLRRYR-EGwAMTQCSD 460
                          *********************.******************************98589**********************.6625566889 PP

                 GRAS 356 gslvlgWkdrpLvsvSaWr 374
                          + ++l+Wk++p+v++SaWr
  Glyma.11G047700.1.p 461 AGIFLTWKEQPVVWASAWR 479
                          9999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.3479459IPR005202Transcription factor GRAS
PfamPF035143.7E-105107479IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MDTTLFRVVS SFQHHQADQD HQSLNNSTTS SSSRSSRQEQ NYPYPQEHDE ECFNFFMDDE  60
DLSSSSSKHY YPYQPHPPST TDHSFSPTPG VDVVFPFEFS SGKWAQDILL ETARAVADKN  120
TTRLQQLMWM LNELSSPYGD TDQKLASYFL QAFFSRITQA GDRTYKTLAS ASEKTCSFES  180
TRKTVLKFQE LSPWTTFGHV ASNGAILEAL EGEPKLHIVD ISNTYCTQWP TLFEALATRN  240
DDTPHLRLTS VVTAGATAQK VMKEIGARME KFARLMGVPF KFNVVHHVGQ LSDLDFSVLD  300
IKEDEALAIN CVNTLHSIAA VGNHRDAVIS SLRRLKPRIV TVVEEEADLD IGLEGFEFVK  360
GFEECLRWFR VYFEALDESF PRTSNERLML ERAAGRAVVD LVACSPADSV ERREKAARWA  420
RRMHGGGGFN TVAFSEEVCD DVRALLRRYR EGWAMTQCSD AGIFLTWKEQ PVVWASAWRA  480
LT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3013947937375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.198290.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353060.0AC235306.1 Glycine max strain Williams 82 clone GM_WBb0068C17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538789.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLI1LH590.0I1LH59_SOYBN; Uncharacterized protein
STRINGGLYMA11G05110.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Representative plantOGRP27551332
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein