PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G045100.1.p
Common NameGLYMA_11G045100, LOC100795135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 284aa    MW: 31683.1 Da    PI: 8.6359
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G045100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.2e-19138192256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Glyma.11G045100.1.p 138 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 192
                          788899***********************************************98 PP

2HD-ZIP_I/II1253.4e-40138227191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +
  Glyma.11G045100.1.p 138 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELK-A 226
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 l 91 
                          l
  Glyma.11G045100.1.p 227 L 227
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.85E-19127195IPR009057Homeodomain-like
PROSITE profilePS5007117.653134194IPR001356Homeobox domain
SMARTSM003891.0E-15136198IPR001356Homeobox domain
PfamPF000463.1E-16138192IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-17138192IPR009057Homeodomain-like
CDDcd000862.22E-17138195No hitNo description
PROSITE patternPS000270169192IPR017970Homeobox, conserved site
SMARTSM003401.1E-24194237IPR003106Leucine zipper, homeobox-associated
PfamPF021839.0E-10194228IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGLDQDANSS GLHLVLGLSL TASVKETAPS TKPDDHHLCV IKPTPTKPYP SKEPSLTLGL  60
SGKGYHVPRN NVAINKVYCE DPLEFSRQTS PHSVVSSFST GRVIKRERDL SCEDMEVDAE  120
ERVSSRVSDE DEDGTNARKK LRLTKEQSAL LEESFKQHST LNPKQKQALA RQLNLRPRQV  180
EVWFQNRRAR TKLKQTEVDC EFLKKCCETL TDENRRLKKE LQELKALKLA QPLYMPMPAA  240
TLTMCPSCER LGGVSDNGSN KSPFSMAPKP HFYNPFANPS AAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186194RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.519900.0leaf| root| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G045100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0994350.0BT099435.1 Soybean clone JCVI-FLGm-23N2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001346165.10.0transcription factor ABIG1-like protein
RefseqXP_028191847.10.0homeobox-leucine zipper protein HAT22-like
SwissprotP466041e-97HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A445HX010.0A0A445HX01_GLYSO; Homeobox-leucine zipper protein HAT22
TrEMBLI1LH340.0I1LH34_SOYBN; Uncharacterized protein
STRINGGLYMA11G04840.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-86HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]