PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G037900.1.p
Common NameGLYMA_11G037900, LOC100798504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 552aa    MW: 60768.4 Da    PI: 6.6674
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G037900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.94.4e-16741135
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                         C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Glyma.11G037900.1.p  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                         ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.4E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.23E-11545No hitNo description
CDDcd002021.50E-16653No hitNo description
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003207.2E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139195.0E-12283371IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLANYTPLHA RAETDDYDDQ  60
RVSRIKSISI NKKKEVALLK RKQNHDNVMS GGFAPDYNQG YQKVVDEDIS NRSSSGSAIS  120
NSESCAQFGY GGMDASDLTG PAQSVVWDAM VPSKKRTCVG RSKPSSVEKL TKDLCTILHE  180
QQSYFSASSE EDLLFESDTP MVSVEIGHGS VLIRHPSYIA REEESEASSL SVDNKQCPMS  240
EAYSCSGGIL MHNDSSRLKS SSLEVEKIGN STGQGVLQEQ LKSDKSQHER VQILGNHESP  300
LCSIDLNDVV NYEEFLRILT NEEQQQLLKL LPVVDTAKLP DSLKVMFNSS QFKENLTYFQ  360
QLLSEGVFDI SLLGAKPEDC KTLKILALSN LSKSKWVEHH NFLKKYKNKA VKSNTMGSTG  420
TASINVLNNR ASTNVANIKR MCDSRNQNFP ELKTIMRSPK RMITKASFEC KEAVEDGACY  480
SPKHLFALPP DASSLLLDSF NFVEESGDQD LLLEVPSNTS FPQAELLHPT LSLGAQASTG  540
SSSVYSNLVH H*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G037900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-145AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539085.10.0GATA transcription factor 26
SwissprotQ8W4H11e-152GAT26_ARATH; GATA transcription factor 26
TrEMBLI1LGU60.0I1LGU6_SOYBN; Uncharacterized protein
STRINGGLYMA11G04060.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44243155
Representative plantOGRP27491530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-145GATA transcription factor 26