PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G035900.1.p
Common NameGLYMA_11G035900, LOC100783851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 286aa    MW: 31968.1 Da    PI: 8.3074
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G035900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-18122176256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Glyma.11G035900.1.p 122 RKKLRLSKDQSIILEESFKEHNTLNPKQKLALAKQLGLRARQVEVWFQNRRARTK 176
                          788899***********************************************98 PP

2HD-ZIP_I/II124.74.2e-40122211191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlsk+q+ +LEesF+e+++L+p++K +la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+ en+rL+kev+eLr +
  Glyma.11G035900.1.p 122 RKKLRLSKDQSIILEESFKEHNTLNPKQKLALAKQLGLRARQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTVENRRLQKEVQELR-A 210
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 l 91 
                          l
  Glyma.11G035900.1.p 211 L 211
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.5E-28394IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.6E-1795179IPR009057Homeodomain-like
SuperFamilySSF466897.27E-18116179IPR009057Homeodomain-like
PROSITE profilePS5007117.086118178IPR001356Homeobox domain
SMARTSM003895.7E-15120182IPR001356Homeobox domain
PfamPF000461.1E-15122176IPR001356Homeobox domain
CDDcd000861.00E-14122179No hitNo description
PRINTSPR000312.4E-5149158IPR000047Helix-turn-helix motif
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PRINTSPR000312.4E-5158174IPR000047Helix-turn-helix motif
PfamPF021834.0E-11178212IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.2E-26178221IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MTVEKEDLGL SLSLSFPQNP PTHLHLNLVS SSPSSHNPQK PSWNDPFTSS AGSSFLRGID  60
VNRLPSVVDC EEEAGVSSPN STVSSVSGKR SEREEANGEE NDTDRACSRG IISDEEDAET  120
SRKKLRLSKD QSIILEESFK EHNTLNPKQK LALAKQLGLR ARQVEVWFQN RRARTKLKQT  180
EVDCEFLKRC CENLTVENRR LQKEVQELRA LKLSPQFYMH MTPPTTLTMC PSCERVAVPP  240
SSAVDPAMRH HHVPPTQPRA FPIGPWATAA ATIPHRPFDA LRRRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126SRKKLRL
2170178RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.172530.0cotyledon| flower| hypocotyl| leaf| meristem| root| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that plays a role in auxin-mediated morphogenesis. Negatively regulates lateral root elongation. {ECO:0000269|PubMed:12492842}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAPTransfer from AT5G47370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G035900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By indole-3-acetic acid (IAA). {ECO:0000269|PubMed:12492842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX924890.0X92489.1 G.max mRNA for homeobox-leucine zipper protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538994.10.0homeobox-leucine zipper protein HAT4
RefseqXP_028191803.10.0homeobox-leucine zipper protein HAT4-like
SwissprotP466011e-110HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLA0A0R0HLM60.0A0A0R0HLM6_SOYBN; Uncharacterized protein
TrEMBLA0A445HWI30.0A0A445HWI3_GLYSO; Homeobox-leucine zipper protein HAT2
STRINGGLYMA11G03850.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-95homeobox protein 2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]