PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G027100.1.p
Common NameGLYMA_11G027100, LOC100787023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 280aa    MW: 31898.1 Da    PI: 6.8476
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G027100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.78.2e-082282612154
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          k +yp+++++++L +++gL+ +q+ +WF N+R +
  Glyma.11G027100.1.p 228 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 261
                          469*****************************87 PP

2ELK25.62.9e-09182203122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK +L++++++++ ++++E++
  Glyma.11G027100.1.p 182 ELKIELKQGFKSRIEDVREEIL 203
                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-191862IPR005540KNOX1
PfamPF037901.2E-172061IPR005540KNOX1
SMARTSM012568.8E-2273128IPR005541KNOX2
PfamPF037918.0E-1776127IPR005541KNOX2
PROSITE profilePS512139.132182202IPR005539ELK domain
PROSITE profilePS5007111.71202265IPR001356Homeobox domain
SuperFamilySSF466892.87E-16204269IPR009057Homeodomain-like
SMARTSM003895.3E-11204269IPR001356Homeobox domain
CDDcd000868.12E-12205266No hitNo description
Gene3DG3DSA:1.10.10.603.7E-25209267IPR009057Homeodomain-like
PfamPF059209.8E-18222261IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MQEAGLGMMG EVSGDQHRQL KAEIATHPLY EQLLAAHVAC LRVATPIDQL PLIDAQLSQS  60
HHLLRSYVSH NTLSLSPHHR QELDNFLAQY LIVLCTFKEQ LQQHVRVHAV EAVMACRDIE  120
NTLQALTGVS LGEGTGATMS DDEDDLQMDF SLDQSSAEGH DMMGFGLPTE SERSLMERVR  180
QELKIELKQG FKSRIEDVRE EILRKRRAGK LPGDTTSVLK NWWQQHAKWP YPTEDDKAKL  240
VEETGLQLKQ INNWFINQRK RNWHSNSQSV TSLKSKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A9e-13205261864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258278RKRNWHSNSQSVTSLKSKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.239480.0cotyledon| pod| root| seed coat| stem
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G027100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0950030.0BT095003.1 Soybean clone JCVI-FLGm-6F23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538444.10.0homeobox protein HD1
RefseqXP_028188931.10.0homeobox protein HD1-like
SwissprotQ9FPQ81e-168KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A0R0HAW90.0A0A0R0HAW9_SOYBN; Uncharacterized protein
TrEMBLA0A445HW430.0A0A445HW43_GLYSO; Homeobox protein knotted-1-like 7 isoform A
STRINGGLYMA11G02960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-171KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]