PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G238100.1.p
Common NameGLYMA_10G238100, LOC100794400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 766aa    MW: 83880.5 Da    PI: 6.053
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G238100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-2068123156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe++F+++++p++++r +L+k+l L+ +qVk+WFqNrR+++k
  Glyma.10G238100.1.p  68 KKRYHRHTPHQIQELEAFFKECPHPDEKQRLDLSKRLALENKQVKFWFQNRRTQMK 123
                          688999***********************************************999 PP

2START180.11.3e-562785012206
                          HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
                START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                          la++a++el+k+ +ae+p+W ks     e+ n +e+ + f++  +     + +ea r++g+v+ ++  lve+l+d + +W e+++    +
  Glyma.10G238100.1.p 278 LALAAMEELLKMTQAESPLWIKSLdgekEMFNHEEYARLFSPCIGpkptgYITEATRETGIVIINSLALVETLMDAN-RWAEMFPsmiaR 366
                          6899********************999999999*******99988********************************.*******99999 PP

                          EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                          a  l+vis+g      galq+m ae q+lsplvp R + f+R+++q+ +g+w++vdvS++   +  + ++v+ +++lpSg+++++++ng+
  Glyma.10G238100.1.p 367 AINLDVISNGmggtrnGALQVMHAEVQLLSPLVPvRQVRFIRFCKQHAEGVWAVVDVSIEIGHDAANAQPVMSCRRLPSGCIVQDMPNGY 456
                          999*********************************************************99999999********************** PP

                          EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          skvtw+eh++++++++h+l+r+l++sg+ +ga +w atlqrqce+
  Glyma.10G238100.1.p 457 SKVTWLEHWEYDENVVHQLYRPLLSSGVGFGAHRWIATLQRQCEC 501
                          *******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-2152119IPR009057Homeodomain-like
SuperFamilySSF466891.45E-1954125IPR009057Homeodomain-like
PROSITE profilePS5007117.29765125IPR001356Homeobox domain
SMARTSM003899.5E-1866129IPR001356Homeobox domain
CDDcd000866.70E-1867125No hitNo description
PfamPF000462.7E-1868123IPR001356Homeobox domain
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PROSITE profilePS5084840.996268504IPR002913START domain
SuperFamilySSF559616.87E-31270501No hitNo description
CDDcd088758.21E-117272500No hitNo description
SMARTSM002341.4E-35277501IPR002913START domain
PfamPF018523.4E-47278501IPR002913START domain
SuperFamilySSF559617.61E-21529759No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MQNSSSFSYS TQRKMEGPSE IGLIGENFDA GLMGRMRDDE YESRSGSDNF EGASGDDQDG  60
GDDQPQRKKR YHRHTPHQIQ ELEAFFKECP HPDEKQRLDL SKRLALENKQ VKFWFQNRRT  120
QMKTQLERHE NIMLRQENDK LRAENSLMKD AMSNPVCNNC GGPAIPGQIS FEEHQIRIEN  180
ARLKDELNRI CALANKFLGK PISSLTNPMA LPTSNSGLEL GIGRNGIGGS STLGTPLPMG  240
LDLGDGVLGT QPAMPGIRPA LGLMGNEVQL ERSMLIDLAL AAMEELLKMT QAESPLWIKS  300
LDGEKEMFNH EEYARLFSPC IGPKPTGYIT EATRETGIVI INSLALVETL MDANRWAEMF  360
PSMIARAINL DVISNGMGGT RNGALQVMHA EVQLLSPLVP VRQVRFIRFC KQHAEGVWAV  420
VDVSIEIGHD AANAQPVMSC RRLPSGCIVQ DMPNGYSKVT WLEHWEYDEN VVHQLYRPLL  480
SSGVGFGAHR WIATLQRQCE CLAILMSSSI SSDDHTALSQ AGRRSMLKLA QRMTSNFCSG  540
VCASSARKWD SLHIGTLGDD MKVMTRKNVD DPGEPPGIVL SAATSVWVPV SRQRLFDFLR  600
DERLRSEWDI LSNGGPMQEM VHIAKGQGHG NCVSLLRANA VNANDSSMLI LQETWMDASC  660
SVVVYAPVDV QSLNVVMSGG DSAYVALLPS GFAILPDGHC NDNGCNGTLQ KGGGGNDGGG  720
SLLTVGFQIL VNSLPTAKLT VESVDTVNNL ISCTIQKIKA SLRVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.130070.0flower| hypocotyl| leaf| somatic embryo
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G238100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589557.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK7LL440.0K7LL44_SOYBN; Uncharacterized protein
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]