PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G230700.1.p
Common NameGLYMA_10G230700, LOC100794389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 313aa    MW: 34753.5 Da    PI: 9.7069
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G230700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.5e-125498147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Glyma.10G230700.1.p 54 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 98
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.07E-1648104IPR009057Homeodomain-like
PROSITE profilePS5129414.1849103IPR017930Myb domain
TIGRFAMsTIGR015571.5E-1852101IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.3E-652104IPR009057Homeodomain-like
SMARTSM007176.5E-1053101IPR001005SANT/Myb domain
PfamPF002494.5E-105498IPR001005SANT/Myb domain
CDDcd001671.17E-75699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MVSKNPNPSE ALNLDPSGMS LPGILPFAAA AAAAVSFEDP AKKTRKPYTI TKSRESWTEP  60
EHDKFLEALQ LFDRDWKKIE AFVGSKTVIQ IRSHAQKYFL KVQKSGTSEH LPPPRPKRKA  120
VHPYPQKASK NVPVLSQVSG SFQSSSALLE PGYILKHDSS AMPKTSIIDT TVSSWSNNYL  180
QKTTNVLHGQ KQKVNNCCSS SESPRAQLVG ESNGRGNNSH PLRVLPDFAE VYNFIGSVFD  240
PNITGHVQKL KRMDPIDVET VLLLMRNLSI NLASPDFEDH RRLLASYEVE PEVDKYINAD  300
RTMLDVRLKS AT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.364980.0seed coat
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G230700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589522.10.0protein REVEILLE 6 isoform X1
RefseqXP_028183079.10.0protein REVEILLE 6-like isoform X1
SwissprotQ8H0W31e-118RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A445IRM60.0A0A445IRM6_GLYSO; Protein REVEILLE 6 isoform A
TrEMBLK7LKZ80.0K7LKZ8_SOYBN; Uncharacterized protein
STRINGGLYMA10G37520.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-113MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]