PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G225200.1.p
Common NameGLYMA_10G225200, LOC100811604
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 668aa    MW: 73467.7 Da    PI: 5.1916
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G225200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.91.7e-3074157186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          rW++qe+laL+++r++m+ ++r+++ k+plWeevs+km+e g++rs+k+Ckek+en+ k++k++keg++++  ++ +t+++fdql+
  Glyma.10G225200.1.p  74 RWPRQETLALLRIRSDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENVYKYHKRTKEGRSGK--QDGKTYRFFDQLQ 157
                          8********************************************************************95..67778******98 PP

2trihelix106.12.4e-33474559187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+k ev+aLi++r++m+e+++++  k+plWee+s+ m++ g++r++k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+ql+a
  Glyma.10G225200.1.p 474 RWPKVEVQALIKLRTSMDEKYQENGPKGPLWEEISASMKKLGYNRNAKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLDA 559
                          8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.1E-471133IPR001005SANT/Myb domain
PROSITE profilePS500906.88873131IPR017877Myb-like domain
CDDcd122038.63E-2573138No hitNo description
PfamPF138375.9E-2073159No hitNo description
SMARTSM007172.7E-4471533IPR001005SANT/Myb domain
CDDcd122032.12E-29473538No hitNo description
PfamPF138375.3E-22473560No hitNo description
Gene3DG3DSA:1.10.10.601.8E-4473530IPR009057Homeodomain-like
PROSITE profilePS500907.201473531IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MLGDSAVLGA GGGGGGGRGG GVESGASADA VAATVTVTHD VATTTGGGGG GSNNSGDDER  60
GRIEEGERSF GGNRWPRQET LALLRIRSDM DVAFRDASVK GPLWEEVSRK MAELGYHRSS  120
KKCKEKFENV YKYHKRTKEG RSGKQDGKTY RFFDQLQALE NHSPTPHSPN PSPKPPQSAP  180
SRVVASSVSL PIATTTTVSL PIPTPTTVPM QPILSNNAIL TSSVPNITVP STTPLPITIP  240
QPILTSPSIN LTIPSYPPTN PTNFPPPPNP TLPSSFPTDT FSNSSSSSTS SEETLEGRRK  300
RKRKWKDFFE RLMKEVIEKQ EELQKKFLEA IEKREDDRIA REEAWRVQEM KRINREREIL  360
AQERSIAAAK DAAVMSFLQK IAEQQNLGQV STNINLVQQP QPQLQPQPPL QQQVTQPSIA  420
AAQPPVQQPP PVVVTQPVVL PVVSQVTNME IVKADNNSNN NNNGENFLAP SSSRWPKVEV  480
QALIKLRTSM DEKYQENGPK GPLWEEISAS MKKLGYNRNA KRCKEKWENI NKYFKKVKES  540
NKRRPEDSKT CPYFHQLDAL YRQKHRGEES PAAVEAKPES AVAPLMVQPE QQWPPQQQQQ  600
DRDITMEDME NEDDEYEEER EGEEELEDDE DEEDEEGGGG GGNYEIVANK TSGGGGASAA  660
SVGASTE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1297302RRKRKR
2297303RRKRKRK
3298303RKRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G225200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536427.10.0trihelix transcription factor GT-2
RefseqXP_028183832.10.0trihelix transcription factor GT-2-like
TrEMBLA0A445IRB50.0A0A445IRB5_GLYSO; Trihelix transcription factor GT-2 isoform A
TrEMBLI1LDG60.0I1LDG6_SOYBN; Uncharacterized protein
STRINGGLYMA10G36960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.14e-53Trihelix family protein