PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G225100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 484aa    MW: 54708.1 Da    PI: 4.9093
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G225100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.91.6e-2969152186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          rW++qe+laL+++r++m+  +r+++lk+plWeev++k++e g++rs+k+Ckek+en+ k++k++keg+++++  + +t+++fdql+
  Glyma.10G225100.1.p  69 RWPRQETLALLKIRSDMDVVFRDSSLKGPLWEEVARKLSELGYHRSAKKCKEKFENVYKYHKRTKEGRSGKH--EGKTYKFFDQLQ 152
                          8********************************************************************964..4457******98 PP

2trihelix103.61.4e-32292377187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+k ev+aLi++r+++e++++++  k+plWe++s+ m + g++rs+k+Ckekwen+nk++kk+ke++k+r  e+s+tcpyf++lea
  Glyma.10G225100.1.p 292 RWPKTEVHALIRLRTSLETKYQENGPKAPLWEDISAGMLRLGYNRSAKRCKEKWENINKYFKKVKESNKQR-REDSKTCPYFNELEA 377
                          8*********************************************************************8.78999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004566128IPR001005SANT/Myb domain
PROSITE profilePS500907.0568126IPR017877Myb-like domain
CDDcd122032.80E-2368133No hitNo description
PfamPF138374.8E-2068154No hitNo description
PROSITE profilePS500907.549285349IPR017877Myb-like domain
SMARTSM007170.091289351IPR001005SANT/Myb domain
CDDcd122038.58E-27291356No hitNo description
PfamPF138372.9E-22291378No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MELGDTTTVM ETSSGEAVAA HGGGEVIMMD ANSGEEENNN HNNKGKLEEG GGEEEEGDNK  60
INNSCGGNRW PRQETLALLK IRSDMDVVFR DSSLKGPLWE EVARKLSELG YHRSAKKCKE  120
KFENVYKYHK RTKEGRSGKH EGKTYKFFDQ LQALENQFTV SSYSPKPQPT LATATTTTNT  180
ITLPPPTRPS AITPISYVTT TVPSTNPTII SPSPPQPPTN ATTTTTITSP TVVTNPRNPP  240
QPNNNNNSNN IPYSLPNMNN LFSTTSTSSS TASDEDLEEK YRKKRNSLSS SRWPKTEVHA  300
LIRLRTSLET KYQENGPKAP LWEDISAGML RLGYNRSAKR CKEKWENINK YFKKVKESNK  360
QRREDSKTCP YFNELEALYK EKSKTQNPFG ASFHNMKPHE MMEPLMVQPE QQWRPPSQYE  420
QGAAKENNNN ERKEREEEEE DEEEEEEEEE DENEEGDLES VEDEGGNRYE IATNKLSSVD  480
TVE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.266850.0cotyledon| epicotyl| hypocotyl| leaf| root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G225100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006590202.10.0trihelix transcription factor GT-2
SwissprotQ391176e-50TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A368ULU00.0A0A368ULU0_SOYBN; Uncharacterized protein
STRINGGLYMA10G36950.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.14e-52Trihelix family protein