PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G215000.1.p
Common NameLOC100809458
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 406aa    MW: 46004.4 Da    PI: 6.3321
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G215000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3051.8e-93244031374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl+ A+ v+++++    + L+ l +++s +gd++qR++ayf+ +Laarl+ + s  y+ l  ++t+    +ee+ a++ ++ vsP+
  Glyma.10G215000.1.p  24 LIHLLLSTATSVDDNNMDSSLENLTDLYQTVSVTGDSVQRVVAYFVDGLAARLLTKKSPFYDMLMEEPTT----EEEFLAFTDLYRVSPY 109
                          689**********************************************************999998887....677888899******* PP

                 GRAS  91 lkfshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelg 173
                          ++f+h+taNqaIlea+e+e     +++H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    s +el+et++rL +f + +g
  Glyma.10G215000.1.p 110 FQFAHFTANQAILEAFEKEeernnRALHVIDFDVSYGFQWPSLIQSLSEKAtsGNRISLRITGFGK----SLKELQETESRLVSFSKGFG 195
                          *****************9988877789**********************99755566*********....9*****************97 PP

                 GRAS 174 .vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                           + fef+ l    l   ++ +Lr k++E++aVnlv  l +l     +  + ++++L +v sl+P +vvvveqe +++  sFl rf+++l+
  Glyma.10G215000.1.p 196 sLVFEFQGL----LRGSRVINLRKKKNETVAVNLVSYLNTLS----CFMK-ISDTLGFVHSLNPSIVVVVEQEGSRSPRSFLSRFTDSLH 276
                          689*****8....77778899***************999997....3333.578************************************ PP

                 GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.s... 346
                          y++a+fdsl+  lp es er  +E++llg+ei++++ +  +      + e++e W++r+e+ GF + ++s+k + qaklll++   +   
  Glyma.10G215000.1.p 277 YFAAMFDSLDDCLPLESAERLRIEKKLLGKEIKSMLNNDVDGgvDCPKYERMEAWKARMENHGFVATKISSKSMIQAKLLLKMRThFcpl 366
                          ************************************9986663356799********************************986433111 PP

                 GRAS 347 ....dg...yrveee.sgslv.lgWkdrpLvsvSaWr 374
                              +g   +rv e+ +g ++ lgW++r L++vSaW+
  Glyma.10G215000.1.p 367 qfeeEGgggFRVSERdEGRAIsLGWQNRFLLTVSAWQ 403
                          1111223347777654555557**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.5941370IPR005202Transcription factor GRAS
PfamPF035146.3E-9124403IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MREQMLRQDH RRKGVVEDGN GLPLIHLLLS TATSVDDNNM DSSLENLTDL YQTVSVTGDS  60
VQRVVAYFVD GLAARLLTKK SPFYDMLMEE PTTEEEFLAF TDLYRVSPYF QFAHFTANQA  120
ILEAFEKEEE RNNRALHVID FDVSYGFQWP SLIQSLSEKA TSGNRISLRI TGFGKSLKEL  180
QETESRLVSF SKGFGSLVFE FQGLLRGSRV INLRKKKNET VAVNLVSYLN TLSCFMKISD  240
TLGFVHSLNP SIVVVVEQEG SRSPRSFLSR FTDSLHYFAA MFDSLDDCLP LESAERLRIE  300
KKLLGKEIKS MLNNDVDGGV DCPKYERMEA WKARMENHGF VATKISSKSM IQAKLLLKMR  360
THFCPLQFEE EGGGGFRVSE RDEGRAISLG WQNRFLLTVS AWQSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-40234033375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535540.10.0PREDICTED: scarecrow-like protein 21
TrEMBLK7LKQ80.0K7LKQ8_SOYBN; Uncharacterized protein
STRINGGLYMA10G35920.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP81961117
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.15e-56GRAS family protein