PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G210500.1.p
Common NameGLYMA_10G210500, LOC100815693
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 348aa    MW: 37354 Da    PI: 5.7267
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G210500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11.1e-17253286134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Glyma.10G210500.1.p 253 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 286
                          99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.9E-753339IPR016679Transcription factor, GATA, plant
SMARTSM004011.7E-16247297IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.583247283IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-14251284IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.24E-14251310No hitNo description
CDDcd002025.14E-14252309No hitNo description
PROSITE patternPS003440253278IPR000679Zinc finger, GATA-type
PfamPF003202.4E-15253286IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MVGPNFMDEI DCGSFFDHID DLLDFPVEDV DGGAATLPSV SAGNSNSLAS IWPSESDSFP  60
ASDSVFSGNS ASDLSAELSV PYEDIVQLEW LSNFVEDSFC GGSLTMNKVE EPSCTTKEDS  120
VNTQFHTSSP VSVLESSSSC SGGKTLPPRS PEIYIPVPCG RARSKRPRPA TFNPRPAMNL  180
ISPASSFVGE NMQPNVISSK ASSDSENFAE SQLVPKMPKL ASGEPKKKKK VKVPLPVAPA  240
DNNQNASQPV RKCMHCEITK TPQWRAGPMG PKTLCNACGV RYKSGRLFPE YRPAASPTFC  300
PSVHSNSHKK VLEMRCRGFD KSGFAINSAA SPELIPNTNS SLTLEYM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164168KRPRP
2224230PKKKKKV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.599720.0cotyledon| hypocotyl| leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G210500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589425.10.0GATA transcription factor 8
RefseqXP_006589426.10.0GATA transcription factor 8
RefseqXP_025979937.10.0GATA transcription factor 8
RefseqXP_028185056.10.0GATA transcription factor 8-like
RefseqXP_028185057.10.0GATA transcription factor 8-like
TrEMBLA0A445IQI40.0A0A445IQI4_GLYSO; GATA transcription factor
TrEMBLK7LKL80.0K7LKL8_SOYBN; GATA transcription factor
STRINGGLYMA10G35470.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48873356
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-44GATA transcription factor 9