PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G190200.1.p
Common NameGLYMA_10G190200, LOC100803245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 489aa    MW: 54187.5 Da    PI: 5.1893
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G190200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.51.2e-1271164741374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                          lv+ L++cA+ v+ gd++ a +l+++++ l a  +    + ++a yf  AL++r+++       +lp+s+++     e+   ++ ++e++
  Glyma.10G190200.1.p 116 LVHMLMTCADSVQRGDFSFAGSLIENMQGLlAHVNTnCGIGKVAGYFIDALRRRISN-------TLPTSSST----YENDVLYHNYYEAC 194
                          689*************************996443332699****************9.......66666665....555567788***** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                          P+lkf+h+taNqaIlea++g+++vH+iDf+++qGlQWpaL+qaLa Rp+gpp lR+Tgvg+p+++++++l+e+g rLa++A++++v+f f
  Glyma.10G190200.1.p 195 PYLKFAHFTANQAILEAFNGHDCVHVIDFNLMQGLQWPALIQALALRPGGPPLLRLTGVGPPSAENRDNLREIGLRLAELARSVNVRFAF 284
                          ****************************************************************************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          + ++a rled+++++L+v+ +Ea+aVn+++qlhr+ + ++++e+    vL+ ++sl+Pk+v+vveqea+hn+e Flerf+eal+yys++f
  Glyma.10G190200.1.p 285 RGVAAWRLEDVKPWMLQVSLNEAVAVNSIMQLHRVTAVDAAVEE----VLSWIRSLNPKIVTVVEQEANHNGEGFLERFTEALHYYSTVF 370
                          **9888******************************88888888....****************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          dsl+a   + + +++ + +++l+rei+nvv+ceg +r erhe l+kWr+rl++aGF+p++l+ +a+kqa++ll  ++ +g+ v+e++gsl
  Glyma.10G190200.1.p 371 DSLDAC--PVEPDKAALAEMYLQREICNVVCCEGPARLERHEPLAKWRDRLGKAGFRPLHLGFNAYKQASMLLTLFSAEGFCVQENQGSL 458
                          ***998..5678888889999********************************************************************* PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          +lgW++rpL+++SaW+
  Glyma.10G190200.1.p 459 TLGWHSRPLIAASAWQ 474
                          ***************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011299.4E-121890No hitNo description
PfamPF120412.3E-261884IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098563.42190454IPR005202Transcription factor GRAS
PfamPF035144.1E-125116474IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MKMISSASNE NKTVVDMDDH LAGLGYKVRS SELCQVAANM ERLENVISST DLSQLASDTT  60
LYDPSNIGLG SWVDTLLSEF DQTASLPLQY DFATDPNHNK QLALVTTVEE DSGIRLVHML  120
MTCADSVQRG DFSFAGSLIE NMQGLLAHVN TNCGIGKVAG YFIDALRRRI SNTLPTSSST  180
YENDVLYHNY YEACPYLKFA HFTANQAILE AFNGHDCVHV IDFNLMQGLQ WPALIQALAL  240
RPGGPPLLRL TGVGPPSAEN RDNLREIGLR LAELARSVNV RFAFRGVAAW RLEDVKPWML  300
QVSLNEAVAV NSIMQLHRVT AVDAAVEEVL SWIRSLNPKI VTVVEQEANH NGEGFLERFT  360
EALHYYSTVF DSLDACPVEP DKAALAEMYL QREICNVVCC EGPARLERHE PLAKWRDRLG  420
KAGFRPLHLG FNAYKQASML LTLFSAEGFC VQENQGSLTL GWHSRPLIAA SAWQAAPLRD  480
DETLRFGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-4915747442375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.420550.0root| seed coat
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589312.10.0PREDICTED: DELLA protein RGA-like
SwissprotQ9LQT81e-152GAI_ARATH; DELLA protein GAI
TrEMBLI1LCF00.0I1LCF0_SOYBN; Uncharacterized protein
STRINGGLYMA10G33380.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-134GRAS family protein