PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G173700.1.p
Common NameGLYMA_10G173700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 337aa    MW: 36957.3 Da    PI: 9.139
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G173700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.6e-3944104262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ke+a++cprC+s ntkfCyynnysl+qPryfCk+CrryWt+GG+lrn+PvGgg+rknk+ss
  Glyma.10G173700.1.p  44 KEQAINCPRCHSINTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNIPVGGGSRKNKRSS 104
                          7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-273696IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3346102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.62148102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MQNSQQECKK KEMVVKPIED IVVTNTTCTK AAVGSVERKP RPQKEQAINC PRCHSINTKF  60
CYYNNYSLTQ PRYFCKTCRR YWTEGGTLRN IPVGGGSRKN KRSSASCSNN SHHNDNNSTN  120
KKLSADLVIT PPTLSHTTQN PKSNDNSIIH QGQDLNLAFP STTTTTSDFR KISELVQQNN  180
NNNSSNNSMS ASSSTTTTTT STSHHLSALE LLTGITSSSS TGLSTSFMPI PVPSNPNSIY  240
TCGFPLQDFK PGTLNFSLDG IGKGYTSLQN VHGGRLLFPF EDLKQVSSTT TMNQTQQGDS  300
TGYWTGMLGG GSWFNWSCQL YIARSALKCV MIMIHE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.289290.0cotyledon| seed coat
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G173700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572690.0DQ857269.1 Glycine max Dof19 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028182659.10.0dof zinc finger protein DOF4.6-like isoform X1
RefseqXP_028182660.10.0dof zinc finger protein DOF4.6-like isoform X1
RefseqXP_028182661.10.0dof zinc finger protein DOF4.6-like isoform X1
RefseqXP_028182662.10.0dof zinc finger protein DOF4.6-like isoform X1
TrEMBLA0A0R0HUU00.0A0A0R0HUU0_SOYBN; Uncharacterized protein
TrEMBLA0A445INU20.0A0A445INU2_GLYSO; Dof zinc finger protein DOF4.6 isoform C
STRINGGLYMA10G31700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.15e-38Dof family protein