PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G082000.1.p
Common NameGLYMA_10G082000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 337aa    MW: 37314.5 Da    PI: 6.4946
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G082000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.45.7e-374094660
               zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                          +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  Glyma.10G082000.1.p 40 PNCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 94
                         58***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-212685IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6774094IPR003851Zinc finger, Dof-type
PfamPF027012.8E-314094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MCIQINFTPT LNVCFGSSSF TCVCFVVMES GWKPEVEISP NCPRCGSSNT KFCYYNNYSL  60
TQPRYFCKGC RRYWTKGGSL RNVPVGGGCR KNRRGNKTLL RQSIDGFTFK NSLPPCGNVT  120
DHNNNPIGHS YDPRIRTSSA SSSSSVVSDG PHIDLALVYA NFLNQKPNSE ARVESTNPDQ  180
VQTVFDPSLE NNSRLSNTVV VGPNTLPEEL GLTGCLNLPE QQPQTHSSEA NNNHNQMCYG  240
EFNTMQTLHQ KDGIDQQCSN HGGGAMNFEL PPLPGEEEVS HDHHMMWSNS EMMINHHHAF  300
QVTQPPLLGP DVHDADLLIG NWSSFDLPRD ASFSRP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G082000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025979763.10.0dof zinc finger protein DOF3.5
TrEMBLK7LI290.0K7LI29_SOYBN; Uncharacterized protein
STRINGGLYMA10G10142.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-42Dof family protein