PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G009200.1.p
Common NameGLYMA_10G009200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 1000aa    MW: 110892 Da    PI: 6.3957
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G009200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.72.2e-40158235178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+C+adls+ak+yhrrhkvCe+hska+ +lv + +qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Glyma.10G009200.1.p 158 VCQVEDCSADLSKAKDYHRRHKVCEMHSKASRALVGNAMQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTNH 235
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-33152220IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18156233IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.05E-37157237IPR004333Transcription factor, SBP-box
PfamPF031103.7E-29159232IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.2E-6748884IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.61E-7770883IPR020683Ankyrin repeat-containing domain
CDDcd002041.78E-6773884No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1000 aa     Download sequence    Send to blast
MEARFGAEAY HFCGVGASSD LRGVGKRSSE WDLNDWRWDG DLFIASRLNP VVPADGVGVG  60
RQFFPTGSGT GILVAGGPSN SSSTSEEVDP RDPKGNKEGD KKRRVIVLED DGLNEEGGTL  120
SLKLGGHASA VVDREVASWD GTNGKKSRVS GSTSNRAVCQ VEDCSADLSK AKDYHRRHKV  180
CEMHSKASRA LVGNAMQRFC QQCSRFHLLQ EFDEGKRSCR RRLAGHNKRR RKTNHEAVPN  240
GSSLNDDQTS SYLLISLLKI LSNMHSDRSD QTTDQDLLTH ILRSLASQNG EQGSKNIANL  300
LREPENLLRE DGSSRKSEMM STLFSNGSQG SPTDTRQHET VSIAKMQQQV MHAHDARAAD  360
QQITSSIKPS MSNSPPAYSE ARDSTAGQIK MNNFDLNDIY IDSDDGMEDL ERLPVSTNLV  420
TSSLDYPWAQ QDSHQSSPPQ TSGNSDSASA QSPSSFSGEA QSRTDRIVFK LFGKEPNDFP  480
LVLRAQILDW LSHSPTDMES YIRPGCIVLT IYLRQAEALW EELCYDLTSS LNRLLDVSDD  540
TFWRNGWVHI RVQHQMAFIF NGQVVIDTSL PFRSNNYSKI LTVSPIAAPA SKRAQFSVKG  600
VNLIRPATRL MCALEGKYLV CEDAHMSMDQ SSKEPDELQC VQFSCSVPVM NGRGFIEEDV  660
CSEICTLEPL LELSETDPDI EGTGKIKAKN QAMDFIHEMG WLLHRSQLKL RMVQLNSSED  720
LFPLKRFKWL IEFSMDHDWC AAVRKLLNLL LDGTVNTGDH PSLYLALSEM GLLHKAVRRN  780
SKQLVECLLR YVPENISDKL GPEDKALVDG ENQTFLFRPD VVGPAGLTPL HIAAGKDGSE  840
DVLDALTNDP CMVGIEAWKN ARDSTGSTPE DYARLRGHYA YIHLVQKKIN KRQGAAHVVV  900
EIPSNTTESN TNEKQNELST TFEIGKAEVI RGQGHCKLCD KRISCRTAVG RSLVYRPAML  960
SMVAIAAVCV CVALLFKSSP EVICMFRPFR WENLDFGTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-31150232384squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.55620.0cotyledon| flower| leaf| root| seed coat| somatic embryo| stem| vegetative bud
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during plant development. {ECO:0000269|PubMed:10524240}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G009200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001352074.10.0squamosa promoter-binding-like protein 1
RefseqXP_028184385.10.0squamosa promoter-binding-like protein 1
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A0R0HMP60.0A0A0R0HMP6_SOYBN; Uncharacterized protein
STRINGGLYMA10G01211.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Representative plantOGRP25951432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Jung S, et al.
    Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes.
    BMC Genomics, 2006. 7: p. 81
    [PMID:16615871]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]