PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G265200.1.p
Common NameGlyma09g40130.1, LOC100783614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 821aa    MW: 89611.7 Da    PI: 6.3731
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G265200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-21119174156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  Glyma.09G265200.1.p 119 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSRRLNLETRQVKFWFQNRRTQMK 174
                          688999***********************************************999 PP

2START208.42.8e-653365601206
                          HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela++a++elvk+a+ +ep+W +s     e++n de+++++++  +     + +ea+r +g+v+ ++  lve+l+d++ +W+e+++    
  Glyma.09G265200.1.p 336 ELALAAMDELVKMAQTDEPLWIRSLeggrEILNHDEYTRTITPCIGlrpngFVTEASRQTGMVIINSLALVETLMDSN-RWSEMFPcmia 424
                          5899*************************************999989***9***************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          + +t evis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g w++vdvS+d  ++ +  + +v +++lpSg+++++++ng
  Glyma.09G265200.1.p 425 RTSTAEVISNGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGLWAVVDVSIDTIRDTSGAPTFVNCRRLPSGCVVQDMPNG 514
                          *****************************************************************999********************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  Glyma.09G265200.1.p 515 YSKVTWVEHAEYDESQIHQLYRPLLSSGMGFGAQRWVATLQRQCEC 560
                          ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.88E-21102176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-22109176IPR009057Homeodomain-like
PROSITE profilePS5007117.783116176IPR001356Homeobox domain
SMARTSM003892.4E-19117180IPR001356Homeobox domain
CDDcd000861.51E-19118176No hitNo description
PfamPF000461.1E-18119174IPR001356Homeobox domain
PROSITE patternPS000270151174IPR017970Homeobox, conserved site
PROSITE profilePS5084845.48327563IPR002913START domain
SuperFamilySSF559612.2E-35329560No hitNo description
CDDcd088756.82E-126331559No hitNo description
SMARTSM002345.6E-48336560IPR002913START domain
PfamPF018526.8E-57336560IPR002913START domain
SuperFamilySSF559611.81E-24588813No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MSFGGFLETK QSGGGGGRIV ADIPYSNNSN NIMPSSAISQ PRLATPTLVK SMFNSPGLSL  60
ALQSDIDGKR DVNRLMPENF EQNGLRRNRE EEHESRSGSD NMDGGSGDDF DAADNPPRKK  120
RYHRHTPQQI QELESLFKEC PHPDEKQRLE LSRRLNLETR QVKFWFQNRR TQMKTQLERH  180
ENSLLRQEND KLRAENMSMR EAMRNPICTN CGGPAMIGEI SLEEQHLRIE NARLKDELDR  240
VCALAGKFLG RPISSLTGSI GPPLPNSSLE LGVGSNGFGG LSTVPSTMPD FGVGISSPLA  300
MVSPSSTRPT TTATTTLVTP PSGFDNRSIE RSIVLELALA AMDELVKMAQ TDEPLWIRSL  360
EGGREILNHD EYTRTITPCI GLRPNGFVTE ASRQTGMVII NSLALVETLM DSNRWSEMFP  420
CMIARTSTAE VISNGINGTR NGALQLMHAE LQVLSPLVPV REVNFLRFCK QHAEGLWAVV  480
DVSIDTIRDT SGAPTFVNCR RLPSGCVVQD MPNGYSKVTW VEHAEYDESQ IHQLYRPLLS  540
SGMGFGAQRW VATLQRQCEC LAILISSAVP SREHSAISSG GRRSMLKLAQ RMTNNFCAGV  600
CASTVHKWNK LNAGNVGEDV RVMTRKSVDD PGEPPGIVLS AATSVWLPVS PQRLFDFLRD  660
ERLRSEWDIL SNGGPMQEMA HIAKGQDHAN CVSLLRASAI NANQSSMLIL QETCTDASGS  720
LVVYAPVDIP AMHVVMNGGD SAYVALLPSG FAIVPDGSVE ENGGASQQRA ASGGCLLTVA  780
FQILVNSLPT AKLTVESVET VNNLISCTVQ KIKSALHCES *
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G265200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311660.0KT031166.1 Glycine max clone HN_CCL_121 homeodomain/HOMEOBOX transcription factor (Glyma09g40130.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534596.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_006587870.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0K2CTQ20.0A0A0K2CTQ2_SOYBN; Homeodomain/HOMEOBOX transcription factor (Fragment)
TrEMBLI1L6R20.0I1L6R2_SOYBN; Uncharacterized protein
STRINGGLYMA09G40130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]