PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G239400.1.p
Common NameGLYMA_09G239400, LOC100797920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 271aa    MW: 30941.8 Da    PI: 6.844
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G239400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.9e-1881133456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          + +++ eq+++Le+ F   +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Glyma.09G239400.1.p  81 KKRLNLEQVKALEKSFDLGNKLEPERKVQLAKALGLQPRQVAIWFQNRRARWK 133
                          4568889*********************************************9 PP

2HD-ZIP_I/II125.81.9e-4079171193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekk+rl+ eqvk+LE+sF+  +kLeperKv+la++Lglqprqva+WFqnrRAR+ktk+lEk+ye+Lk++++a+k++n+ L+ e+++L++e
  Glyma.09G239400.1.p  79 EKKKRLNLEQVKALEKSFDLGNKLEPERKVQLAKALGLQPRQVAIWFQNRRARWKTKHLEKEYEVLKKQFEAVKADNDVLKVENQKLQAE 168
                          69***************************************************************************************9 PP

          HD-ZIP_I/II  91 lke 93 
                          l++
  Glyma.09G239400.1.p 169 LQA 171
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.45575135IPR001356Homeobox domain
SuperFamilySSF466891.58E-1877136IPR009057Homeodomain-like
SMARTSM003898.5E-1878139IPR001356Homeobox domain
CDDcd000861.27E-1580136No hitNo description
PfamPF000461.5E-1581133IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.2E-1987134IPR009057Homeodomain-like
PRINTSPR000317.3E-6106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000317.3E-6115131IPR000047Helix-turn-helix motif
PfamPF021833.8E-12135174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MAFPPPHGFT FNTTHEEDHH HLPPTSLNPF PSLPPQHFQG GASFMLKRSM SFSGIENKCD  60
EVLHGDDELS DDGIFQCGEK KKRLNLEQVK ALEKSFDLGN KLEPERKVQL AKALGLQPRQ  120
VAIWFQNRRA RWKTKHLEKE YEVLKKQFEA VKADNDVLKV ENQKLQAELQ AVKSRDWCEA  180
GMMSHKKETE GSWSNGSDNS LEINLDHSRT LGLNSPISSQ NGKNLLLPNS LNPTSITQLL  240
QDDGLCNMFH NIDAQQNFWP WPDQQHQRFH *
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G239400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351191e-155AC235119.1 Glycine max strain Williams 82 clone GM_WBa0029B22, complete sequence.
GenBankAC2352401e-155AC235240.1 Glycine max strain Williams 82 clone GM_WBb0029M05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534456.10.0homeobox-leucine zipper protein HAT7
RefseqXP_028180316.10.0homeobox-leucine zipper protein HAT7-like
SwissprotQ004668e-74HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLI1L5Z00.0I1L5Z0_SOYBN; Uncharacterized protein
STRINGGLYMA09G37410.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.13e-75homeobox 3