PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G237000.1.p
Common NameGLYMA_09G237000, LOC100784308
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 504aa    MW: 54673.3 Da    PI: 6.5094
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G237000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.77.2e-40138198262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk++ 
  Glyma.09G237000.1.p 138 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSVA 198
                          7899******************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-31135195IPR003851Zinc finger, Dof-type
PfamPF027012.5E-32140196IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.947142196IPR003851Zinc finger, Dof-type
PROSITE patternPS013610144180IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MSEAKDPAIK LFGKTIPVPE ILPGSNGAPA SSSGDVVVDD SVDASSTNSS RESHTNTDAQ  60
EKDFDKDTLG EKPTDDKKED GAPAQSSEEV ANPDTASGTC EESIIQSTER EATTLKTTKT  120
EEEQGETSNS QDKNLKKPDK ILPCPRCNSM DTKFCYYNNY NVNQPRHFCK NCQRYWTAGG  180
TMRNVPVGAG RRKNKSVASH YRQITVSEAA LQNPRTDLPN GAYHPSLKCN GTVLTFGTDT  240
PLCESMASVL NLADKTMHNY TRNGFHKPEE LRIPVSHASG EKGDDQSNKS SVTSTTSVEG  300
ASTNRPKEQV MQNCQSSPSQ VPYFPGTPWP IPWNPVQWSS PVPPPAFCPP GFTMPFYPAT  360
AYWGCAMPGT WNIPWLAQPS SPNGATPNSG PNSPTLGKHS REDYTFKPNE SGGEDGHSKE  420
NNKEKSLWVP KTLRIDDSGE AAKSSIWATL GIKNDKADSV PGGTLFKAFP SKHDDKNHSM  480
QSSRVLLANP AALSRSLNFH ETS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.288820.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G237000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533537.10.0cyclic dof factor 2
TrEMBLI1L5W60.0I1L5W6_SOYBN; Uncharacterized protein
STRINGGLYMA09G37170.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-102cycling DOF factor 2