PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G201000.1.p
Common NameGLYMA_09G201000, LOC100777894
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 343aa    MW: 36975.4 Da    PI: 8.5597
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G201000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-393494262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         +e+ l+cprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk++
  Glyma.09G201000.1.p 34 QEQGLNCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKVK 94
                         57889*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.9E-333692IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-263792IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3573892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSPDDTPSKP ATAKDQETQS SGGSGRKSSS TRPQEQGLNC PRCDSPNTKF CYYNNYSLTQ  60
PRHFCKTCRR YWTKGGALRN VPIGGGCRKN KKVKSSRLSC DSKDSGSSSS EVGGLKFLHS  120
LSPSMDFHLG GLPFPRLHHH HHPPTTYNHF SSFENTSSTS SCFNLDPSPG TTTTLSSSFA  180
ALYNYPFSYN GAIQGMSSLN VHSGLASSIE SLSSINQDLH WKLQQQRLAM LFGGDNNQKD  240
HSGVNQIENQ TQKPQTILFQ NLEISKPGTF PVGDSRKEHG PSGDTHTPST EWFFGNSYAS  300
VTPTPTSSGG GPGNNDNASN WSSGGGGVHA WGDVPQQYSS LP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G201000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534250.10.0dof zinc finger protein DOF5.7
RefseqXP_028180270.10.0dof zinc finger protein DOF5.7-like
TrEMBLA0A445J3P20.0A0A445J3P2_GLYSO; Dof zinc finger protein DOF5.7
TrEMBLI1L4T30.0I1L4T3_SOYBN; Uncharacterized protein
STRINGGLYMA09G33350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-33TARGET OF MONOPTEROS 6