PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G178000.1.p
Common NameGLYMA_09G178000, LOC778073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 972aa    MW: 108517 Da    PI: 4.9747
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G178000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73e-09437481246
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          g+WT eEd+ l+  v+ +G ++W  Ia+ +g+ Rt+ qc  r+q 
  Glyma.09G178000.1.p 437 GAWTNEEDKSLLLIVQDMGIRNWFDIAASLGTSRTPFQCLARFQR 481
                          79***************************************9995 PP

2Myb_DNA-binding383.7e-12491533346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           WT+eEd +l  av+ +G ++W ++a+ +  +Rt+ qc +rw k
  Glyma.09G178000.1.p 491 EWTEEEDSQLCSAVACFGARDWQSVASVLE-RRTGTQCSNRWKK 533
                          7*****************************.***********87 PP

3Myb_DNA-binding40.56.3e-13540583146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++T+eEd +l  av ++G + W+ Ia++++ gR   qc++r+++
  Glyma.09G178000.1.p 540 KGSFTQEEDIRLTVAVMLFGRK-WNQIANYVP-GRIQSQCRDRYLN 583
                          799*****************99.*********.***********98 PP

4Myb_DNA-binding476.1e-15593634346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           WT+eEd++l  a+ ++G   W++Ia++++  Rt+ qc+ rw  
  Glyma.09G178000.1.p 593 GWTEEEDLRLEAAIVKHGYC-WSKIAEEVP-PRTDSQCRKRWKV 634
                          5*****************99.*********.9**********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.645332428IPR017877Myb-like domain
SMARTSM007170.014336432IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-11339355IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-11403442IPR009057Homeodomain-like
SuperFamilySSF466893.59E-16412480IPR009057Homeodomain-like
PROSITE profilePS500909.605431483IPR017877Myb-like domain
SMARTSM007176.9E-9435485IPR001005SANT/Myb domain
CDDcd001679.42E-7438483No hitNo description
PfamPF139215.0E-14439500No hitNo description
Gene3DG3DSA:1.10.10.604.3E-14443496IPR009057Homeodomain-like
PROSITE profilePS5129416.388484539IPR017930Myb domain
SuperFamilySSF466892.05E-21488581IPR009057Homeodomain-like
SMARTSM007177.7E-8488537IPR001005SANT/Myb domain
CDDcd001674.89E-10491533No hitNo description
Gene3DG3DSA:1.10.10.601.6E-16497546IPR009057Homeodomain-like
SMARTSM007172.7E-12539587IPR001005SANT/Myb domain
PROSITE profilePS512949.821540585IPR017930Myb domain
PfamPF002496.1E-12540583IPR001005SANT/Myb domain
CDDcd001671.50E-7542585No hitNo description
Gene3DG3DSA:1.10.10.602.1E-18547592IPR009057Homeodomain-like
SuperFamilySSF466891.1E-22565636IPR009057Homeodomain-like
PROSITE profilePS5129421.803586640IPR017930Myb domain
SMARTSM007175.1E-13590638IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-16593635IPR009057Homeodomain-like
PfamPF002491.7E-13593634IPR001005SANT/Myb domain
CDDcd001677.02E-13594635No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MTPRVDDFEK DDLSASDDDD DDDDDGLKED MAALARACTI AVPCPDDNST AEDDVPAEDP  60
LLHAGDSIVP AATDSDDDQD DLECLKRVQS LYQPLSVLPP LTPPAAVSDD DDDGVDDLET  120
VRAIMKRFST YGEGSHEGGM QMLVEGDQTS SPGYEGDIAN GSIHYESDAG ELCPVSQDPN  180
EAATEELIEN VEMKLSDFVE SSEPDAYESS KLPQKRLSCP PVVRCFVDAI NKNRDLQRFI  240
RSKLIELEAK IEENKKIRNK IKILKDFQAS CTRRTGNALS MKKDPRVQLI SSKKPFAPKN  300
SKQKHKKASA MCYGPEENSH VANYRMVLER FPLSLDRKKW SSVERESLLK GIKQQFQEMV  360
LQLSLSVDSS EGLLGDANDM DNVIASVKDL EITPERIRQF LPKVNWDLIA SMYVGGRNGA  420
ECESRWLNCE DPLINQGAWT NEEDKSLLLI VQDMGIRNWF DIAASLGTSR TPFQCLARFQ  480
RSLNPAMLNS EWTEEEDSQL CSAVACFGAR DWQSVASVLE RRTGTQCSNR WKKSICPEKK  540
GSFTQEEDIR LTVAVMLFGR KWNQIANYVP GRIQSQCRDR YLNSLDPSLK WGGWTEEEDL  600
RLEAAIVKHG YCWSKIAEEV PPRTDSQCRK RWKVLCPECV PLLQEARKKR RSIIGSNFVD  660
RESERPAITL NDFLPSPALA PKSDVGASNL CKKRKSSNVP KETSKKCIKR TRLRTKEVQD  720
TEVYSDDGIK TCGEVVSACR NVSKKMRSKR HTKNTQNCPK EVVDISCSDK VKTCIESSES  780
QSTFIASSGN QDSDNITIVC FLRDKSKEML SRFTKDLCQA SFSARITDVS RQVESQDPFD  840
DQIISLSQSC DTVGTKNLFV QQKAASDTLV GTPEDANTLT GNDDDMTLAC FLGNKPKKGS  900
QAANRRSACS STIIIPDGSG LSRSKHVEEE TVLHGGVAEP MDIVVEKKDD ELLTSLQNRP  960
TRQRKRPSRF L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C8e-294056327155MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-294056327155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1628650RKRWKVLCPECVPLLQEARKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.285930.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-154AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533344.10.0PREDICTED: uncharacterized protein LOC778073 isoform X1
TrEMBLA0A0R0IFW00.0A0A0R0IFW0_SOYBN; Uncharacterized protein
STRINGGLYMA09G30891.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-163myb domain protein 4r1