PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G143700.1.p
Common NameGLYMA_09G143700, LOC100820113
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 777aa    MW: 85098.7 Da    PI: 5.552
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G143700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.96.5e-2289144156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++k +++t++q++eLe++F+++++p++++r++L+k+lgL+ +qVk+WFqNrR+++k
  Glyma.09G143700.1.p  89 KKKYHRHTPQQIQELEAFFKECPHPDEKQRTDLSKRLGLENKQVKFWFQNRRTQMK 144
                          79999************************************************999 PP

2START174.56.7e-553015232205
                          HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
                START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                          la+ a++el+k+a+ +  +W kss    e +n de+ + f++  +     + +ea r +gvv++ +   ve+l+d+  +W e++     +
  Glyma.09G143700.1.p 301 LALNAMNELIKMAQPDTSLWIKSSdgrnEVLNHDEYARLFSPYVGskpagYVTEATRGTGVVPASSLGIVETLMDVD-RWAEMFSsmiaS 389
                          6789********************9999999*********99666999*****************************.9****999999* PP

                          EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                          a+tlev+ssg      galq+m ae q+lsplvp R   f+Ry++q+g+g+w++vdvSvd  +++++s++++ +++lpSg++i++++ng 
  Glyma.09G143700.1.p 390 AATLEVLSSGmgesrsGALQVMLAEVQLLSPLVPaRSLSFLRYSKQHGEGVWAVVDVSVDIGRNVTNSHPLMSCRRLPSGCVIQDMPNGF 479
                          ****************************************************************************************** PP

                          EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          sk+twveh  ++++++h+l+r+lv+sg+ +ga++w atl rqc 
  Glyma.09G143700.1.p 480 SKITWVEHSQYDESVVHQLYRPLVSSGIGFGAQRWIATLLRQCD 523
                          *****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.68E-2169146IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-2374140IPR009057Homeodomain-like
PROSITE profilePS5007117.96186146IPR001356Homeobox domain
SMARTSM003892.5E-1988150IPR001356Homeobox domain
PfamPF000461.9E-1989144IPR001356Homeobox domain
CDDcd000864.53E-1893146No hitNo description
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PROSITE profilePS5084844.133291527IPR002913START domain
SuperFamilySSF559611.18E-33293524No hitNo description
CDDcd088751.08E-109295522No hitNo description
SMARTSM002343.3E-38300524IPR002913START domain
PfamPF018522.5E-46301523IPR002913START domain
SuperFamilySSF559612.89E-17543745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MASVYTVDPH LFSSPFDISK QNPSTLNLAA QRRMEGHSEM GQIGESFDTS NLLGRLRDDE  60
YESRSGSDNF DGGSGDDQDA GDDQPHKKKK KYHRHTPQQI QELEAFFKEC PHPDEKQRTD  120
LSKRLGLENK QVKFWFQNRR TQMKTQLERH ENMILRQEND KLRAENSVMK DALANPTCNN  180
CGGPAIPGQI SLEEHQTRME NARLKDELNR ICALANKFLG RPLSPLASPM ALPPSNSGLE  240
LAIGRNGIGG PSNFGMSLPM GFDVGDGVMG SSPGMSSMGA RSPMGMMGNE IQLERSMLLD  300
LALNAMNELI KMAQPDTSLW IKSSDGRNEV LNHDEYARLF SPYVGSKPAG YVTEATRGTG  360
VVPASSLGIV ETLMDVDRWA EMFSSMIASA ATLEVLSSGM GESRSGALQV MLAEVQLLSP  420
LVPARSLSFL RYSKQHGEGV WAVVDVSVDI GRNVTNSHPL MSCRRLPSGC VIQDMPNGFS  480
KITWVEHSQY DESVVHQLYR PLVSSGIGFG AQRWIATLLR QCDCLAILMS QIPSEDPTVI  540
SLEGKKNMLK LAQRMTEYFC SGICASSVRK WEILNIGNLA DDMRIMARKI NMDDPTEAPG  600
IVLSASTSVW MPVSRQRVFD FLRDENLRGE WDMLSKDGPM KEMLHIAKGQ DRGNCVSILH  660
SANSECNVLY LQESWTDASG SLVVYSPINM QALNMVMNCG DSSFVALRPS GFAILPDGAS  720
NNGDGSDGGG SCLLTVGLQM LPNGDQSTKF TMESVVTVNS LISNTIQKVK DALGVA*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G143700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587344.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_028180201.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK7LDX20.0K7LDX2_SOYBN; Uncharacterized protein
STRINGGLYMA09G26600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]