PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G113800.1.p
Common NameGLYMA_09G113800, LOC100789301
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 374aa    MW: 40033.5 Da    PI: 9.0931
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G113800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP139.41e-4376152177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +CqvegC++dls ak y++rhkvC++hsk p+v+v+gleqrfCqqCsrfh lsefDe+krsCrrrLa+hnerrrk+ 
  Glyma.09G113800.1.p  76 RCQVEGCKVDLSGAKAYYSRHKVCTMHSKFPTVIVAGLEQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNERRRKPP 152
                          6**************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.8E-3670138IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.60774151IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-4175155IPR004333Transcription factor, SBP-box
PfamPF031103.2E-3377150IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MSSGSVTKAP PPSSSSSPNS SSESLDGLKF GQKIYFEDVS VAATTTTQGA YKTSRVVSSP  60
SSASKKGRGG SLQPPRCQVE GCKVDLSGAK AYYSRHKVCT MHSKFPTVIV AGLEQRFCQQ  120
CSRFHLLSEF DEGKRSCRRR LAGHNERRRK PPPSSTLASH YGRLSTPIFD NSGRAGGFLM  180
EFASYPKVTL RNTLPTQRSA EPALGNHAAT LTWQGSSDTP SEFFLQESGS GGTSFLGSKH  240
PLLESYTGVT DSNCALSLLS RQTWGSRNTA PATSVELNNN LLNFNGTSMT QFSAASSQTA  300
AIHQLPNATS WLYLKGVGSG DCSPEGVPDL GLGQISPPLD SHLHGELNVS QQGRRHYMDL  360
GESRACESSH WSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31771501184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G113800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551421.10.0squamosa promoter-binding-like protein 9
TrEMBLI1N2A20.0I1N2A2_SOYBN; Uncharacterized protein
STRINGGLYMA18G36960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-56squamosa promoter binding protein-like 9