PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G082000.1.p
Common NameGLYMA_09G082000, LOC100776125
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 1033aa    MW: 114110 Da    PI: 7.0001
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G082000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.6e-41147223177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cqve+C+adls+ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+ 
  Glyma.09G082000.1.p 147 VCQVEDCRADLSNAKDYHRRHKVCDMHSKATQALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTL 223
                          6*************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-32142209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.077145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-38146227IPR004333Transcription factor, SBP-box
PfamPF031104.2E-29148221IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.49E-7803919IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.5E-6804915IPR020683Ankyrin repeat-containing domain
CDDcd002046.95E-8804914No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1033 aa     Download sequence    Send to blast
MESQLEGKNQ YLYGPVVPEM KSVGKRSLEW DLNDWKWDGD LFTARQLNSV PSDCRSRELF  60
PTDPEILATG GASNSLSSAY DDANLGEGKR ELEKRRRGVN DDGGVEMNDG AGSLNLNLGG  120
QVYPIMEGEE KSGKKTKMTA STSSRAVCQV EDCRADLSNA KDYHRRHKVC DMHSKATQAL  180
VGNVMQRFCQ QCSRFHVLQE FDEGKRSCRR RLAGHNKRRR KTLPDATVVN GGSLNEEKGS  240
SYLLMSLLRI LSNMHSNGSD NMRNQDVLSH LLRNLASLAG TINGRNIVSL LEGSQGLVKA  300
GTSGAAQNVP NTNSDGPEPS RPFDSFIKMD DGLIHRDPPE SMVQRETTPA NDMAKKCIAS  360
GSDGVGSLKS PSVPQSSNVL LSRDGLPPQS VAAQTTVGRI GLSNIDLNNV YDDVQDYVEN  420
TRNSCPPLPS GNGSLDHPLW IQCDSLKSSP PQTSRNSDST STQSPSSSSG EAQSRTDRIV  480
FKLFGKAPND FPHALRSQIL NWLSHSPTEI ESYIRPGCII LTIYLRLENS AWEELCYNLE  540
SSLRKLAAPN DSFWRTGWIY TRVQHSVAFL YNGQVVLDAP LRLKSPQNCQ ILCVKPLAVS  600
ASSSAQFVVK GFNFLLSNTR LLCALEGKYL VQDSCYDLID SADAVNGHQE LQHLSFSCHV  660
PNVTGRGFIE VEDNGLSSCS FPFIVAEQEI CLEICTLDNV IEAAEMADDN QIKTNLMEEK  720
TQALYFIQEM GWLLHRSRVK VRLGPMAPVQ DRFHFNRFIW LVGFSMDHDW CAVMKKLLNI  780
IFEGTVDTGD HASVELALLE MGLLHKAVKR NCRPMVEILL KFVPVKASDG GDSNEKQVNK  840
SPDRFIFRPD TVGPVGLTPL HVAASMHGSE NVLDALTDDP GMVGTEAWKS AQDATGLTPY  900
DYASMRGYYS YIQLVQSKTS NTCKSQHVLD IPGTLVDSNT KQKQSDRHRS SKVSSLQTEK  960
IETTAMPRRC GLCQQKLAYG GMRRALVYRP AMLSMVAIAA VCVCVALLFK SSPKVYYVFQ  1020
PFSWESLEYG SI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-30139221284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.104040.0leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G082000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534999.10.0squamosa promoter-binding-like protein 1
TrEMBLI1L2060.0I1L206_SOYBN; Uncharacterized protein
STRINGGLYMA09G09790.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Representative plantOGRP25951432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1