PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G062400.1.p
Common NameGLYMA_09G062400, LOC100790522
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 238aa    MW: 26645.3 Da    PI: 8.329
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G062400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.4e-1990144256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++tkeq  +Le+ F+ +++++ ++++ LA++l+L+ rqV vWFqNrRa+ k
  Glyma.09G062400.1.p  90 RKKLKLTKEQSATLEDIFKLHSTLNPAQKQALAEQLNLKHRQVEVWFQNRRARTK 144
                          788899***********************************************98 PP

2HD-ZIP_I/II116.91.1e-3790179190
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk++l+keq+++LE+ F+ +++L+p +K++la++L+l+ rqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eLr++
  Glyma.09G062400.1.p  90 RKKLKLTKEQSATLEDIFKLHSTLNPAQKQALAEQLNLKHRQVEVWFQNRRARTKLKQTEVDCEFLKKCCEKLTDENQRLKKELQELRAQ 179
                          69*************************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-1875140IPR009057Homeodomain-like
SuperFamilySSF466891.03E-1877147IPR009057Homeodomain-like
PROSITE profilePS5007117.03886146IPR001356Homeobox domain
SMARTSM003891.9E-1588150IPR001356Homeobox domain
CDDcd000869.33E-1590147No hitNo description
PfamPF000462.3E-1690144IPR001356Homeobox domain
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PfamPF021831.9E-10146180IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.5E-22146189IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MEDDEACITS LSLGLGIMGG HAQKKENEQK VHCLDLSFEL CPKGKEEVEE AIDVDQQQQQ  60
HANKAKGLLC LKHPNDETSP DSNNSNNGSR KKLKLTKEQS ATLEDIFKLH STLNPAQKQA  120
LAEQLNLKHR QVEVWFQNRR ARTKLKQTEV DCEFLKKCCE KLTDENQRLK KELQELRAQK  180
IGPTPLYIQL SKATTLTICS SCEKLLKPNE GNNKGAISNV IRNSSNKLKN SIELGGI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138146RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.521250.0somatic embryo
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G062400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311720.0KT031172.1 Glycine max clone HN_CCL_117 homeodomain/HOMEOBOX transcription factor (Glyma15g18320.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587005.11e-172homeobox-leucine zipper protein HAT22
RefseqXP_028180487.11e-172homeobox-leucine zipper protein HAT22-like
SwissprotP466656e-54HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A445IXY41e-171A0A445IXY4_GLYSO; Homeobox-leucine zipper protein HAT14
TrEMBLK7LC401e-171K7LC40_SOYBN; Uncharacterized protein
STRINGGLYMA09G07051.11e-172(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56642851
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-56homeobox from Arabidopsis thaliana