PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G011800.1.p
Common NameGLYMA_09G011800, LOC100817987
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 549aa    MW: 61274.9 Da    PI: 6.2277
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G011800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.51.7e-1291755461374
                 GRAS   1 lvelLlecAeavssgdlelaqalLar.lselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                          l+e+L++cA+av+++d e a  ++++ l +++s  gdp+qRl ay++e+L+arl +s+s +ykal++++ +   s + +++++++++++P
  Glyma.09G011800.1.p 175 LKEVLIRCAQAVADDDIETAVGFMNNvLAKMVSVGGDPIQRLGAYMLEGLRARLESSGSIIYKALKCEQPT---SNDLMTYMHILYQICP 261
                          5789********************872566799999**********************************9...89999999******** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                          + kf++  aN  I ea+ +e+r+HiiDf++ qG+QW+ L+qaLasRp+g+p +R+Tgv++++s+  +   l+ +g+rL+++A+++gvpfe
  Glyma.09G011800.1.p 262 YWKFAYTSANAVIGEAMLNESRIHIIDFQVAQGTQWLLLIQALASRPGGAPFIRVTGVDDSQSFhaRGGGLHIVGKRLSDYAKSCGVPFE 351
                          ************************************************************9999889999******************** PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          f+  +a   ++lele+L ++pgEal+Vn+ + lh+++desvs+e++rd++L+lvkslsPkvv++veqe+++n+++F++rf+e+l+yy+a+
  Glyma.09G011800.1.p 352 FHS-AAMCGSELELENLVIQPGEALVVNFPFVLHHMPDESVSTENHRDRLLRLVKSLSPKVVTLVEQESNTNTSPFFQRFVETLSYYTAM 440
                          ***.899*********************************************************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          f+s+++ lpr++++ri+ E+++++r+ivn+vaceg+er erhe l+kWr+r+++aGF p pls+++++ ++ +l++++++ yr+++++g+
  Glyma.09G011800.1.p 441 FESIDVALPRDDKQRINAEQHCVARDIVNMVACEGDERLERHELLGKWRSRFSMAGFAPCPLSSSVTAAVRNMLNEFNEN-YRLQHRDGA 529
                          ******************************************************************************55.********* PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          l+lgWk+r++ + SaWr
  Glyma.09G011800.1.p 530 LYLGWKSRAMCTSSAWR 546
                          ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.468149527IPR005202Transcription factor GRAS
PfamPF035145.8E-127175546IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MQTSKKHPTS AGIHLYLQPA QDIDPYTHYQ ILQSNSCHDN SSSQGTTISF ETSKEQYFTL  60
ESSPAINDLI GCDSPSYASV SSNRSPFSPQ ASHSDQHQSS DNTYGSPTSA HSRYDDDGYE  120
LKNKLRELEI SLLGPDSDIV DSWHCSYKGG RHRASSPTAK HNWDQIVEMI PKLDLKEVLI  180
RCAQAVADDD IETAVGFMNN VLAKMVSVGG DPIQRLGAYM LEGLRARLES SGSIIYKALK  240
CEQPTSNDLM TYMHILYQIC PYWKFAYTSA NAVIGEAMLN ESRIHIIDFQ VAQGTQWLLL  300
IQALASRPGG APFIRVTGVD DSQSFHARGG GLHIVGKRLS DYAKSCGVPF EFHSAAMCGS  360
ELELENLVIQ PGEALVVNFP FVLHHMPDES VSTENHRDRL LRLVKSLSPK VVTLVEQESN  420
TNTSPFFQRF VETLSYYTAM FESIDVALPR DDKQRINAEQ HCVARDIVNM VACEGDERLE  480
RHELLGKWRS RFSMAGFAPC PLSSSVTAAV RNMLNEFNEN YRLQHRDGAL YLGWKSRAMC  540
TSSAWRCY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-611795468375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.595480.0leaf| meristem| pod| seed coat
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534887.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_014617311.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_014617312.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLI1L0130.0I1L013_SOYBN; Uncharacterized protein
STRINGGLYMA09G01440.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Representative plantOGRP14091447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13