PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G358100.1.p
Common NameGLYMA_08G358100, LOC100796820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 368aa    MW: 38568.5 Da    PI: 8.8489
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G358100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.31.6e-3881139361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          e+++kcprC+stntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+nk+s
  Glyma.08G358100.1.p  81 EAQQKCPRCESTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKRS 139
                          6789****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2964129IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3282138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.34884138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MVYTSIPAYI DPANWQQQQP NHQQQGNNTA ASSHLILPQP IQPPQPPPSQ PHGLGGSTTA  60
GSIRPGSMAD RARMANIPMQ EAQQKCPRCE STNTKFCYFN NYSLSQPRHF CKACRRYWTR  120
GGALRNVPVG GGCRRNKRSR GSSGNNTRSP ANSDRQTASA GSASTTSGSS SADLVAGLGG  180
GTGVPPSLRF MAPLHQLGDH HHHLGGGGGE IGLSYGLNYG AISGPMGGIG DLNFHIGGSL  240
SGGGCSMLSG LEQWRVPQTH QFPFLSGLEA TSSHGLYPFE GASGSDGYGS TPIKVSTSGV  300
MSQLASVKME DNHHHHHQEL GLPRQFLGVN NNPSTNEQYW SGGGGATSAW TDLSAFSSSS  360
TTSNNAL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G358100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003532312.10.0dof zinc finger protein DOF2.4
TrEMBLI1KZD70.0I1KZD7_SOYBN; Uncharacterized protein
STRINGGLYMA08G47290.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-36Dof family protein