PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G276300.1.p
Common NameGLYMA_08G276300, LOC102660774
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 404aa    MW: 43341.4 Da    PI: 8.277
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G276300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-393392261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         +e+ +kcprCds+ntkfCyynnysl+qPr+fCk+CrryWt+GGalrnvP+Ggg+rknk++
  Glyma.08G276300.1.p 33 PEQGVKCPRCDSSNTKFCYYNNYSLTQPRHFCKTCRRYWTNGGALRNVPIGGGCRKNKRV 92
                         67899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-273191IPR003851Zinc finger, Dof-type
PfamPF027018.0E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3663791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MATAPATKDQ EPTQGRKFTT TTTTTTTTTR PAPEQGVKCP RCDSSNTKFC YYNNYSLTQP  60
RHFCKTCRRY WTNGGALRNV PIGGGCRKNK RVVVKPSSSS SSSLSSSPRF SNEFSLRGLN  120
VPPSVEFNLG ALPFPASSRL NIPTTLNTGL FSNQFSSSPL SFGGDVNSVS VTNNALSGFQ  180
LDATPATVLS NSLMSLASNN NTQNNNNFWA LQDRSQGSTL LLSDSFNSSA MQSMQQSLNV  240
HSSLASSIES LSCVNQDLHL KMQQQRYATM MFGGDSYHHK GGGGGGGDEN NGVSFSQTAN  300
RFENQKQLVG NPVMFQNLEI SKPPGSSVTE DPSGATVTTT VAPPTEWFFG NSSFSSAGNG  360
NDGANSNNNN INININDANN NWSDALAWGD FQQQQQQQYS ALP*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO229273030.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G276300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006586514.10.0dof zinc finger protein DOF5.7
RefseqXP_028246795.10.0dof zinc finger protein DOF5.7-like
TrEMBLA0A0B2QWH10.0A0A0B2QWH1_GLYSO; Dof zinc finger protein DOF5.7
TrEMBLI1KX560.0I1KX56_SOYBN; Uncharacterized protein
STRINGGLYMA08G37530.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-33OBF-binding protein 3