PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G256400.1.p
Common NameGLYMA_08G256400, LOC100792572
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TCP
Protein Properties Length: 371aa    MW: 41199.2 Da    PI: 8.8228
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G256400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1486.3e-46972292130
                  TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec....eaesssssasnsss 87 
                          a+kkdrhskihT++g+RdRRvRls+e+a++fFdLqd+LGfdk+s+t++WL++++k+aikelt+++ s+ s+     ++++ +s+ +++ +
  Glyma.08G256400.1.p  97 ATKKDRHSKIHTSQGLRDRRVRLSIEIARKFFDLQDMLGFDKASNTLDWLFTKSKKAIKELTRSKHSADSFEfsssSDGEVVSTIHQDLH 186
                          89**************************************************************66666333345355555555555555 PP

                  TCP  88 gkaaksaakskksqksaasalnlakesrakarararertrekm 130
                          +++  + +++k ++  a ++ +++kesr+kararar+rt++k 
  Glyma.08G256400.1.p 187 QQQGVDLEEGKLKEPAAYCVKAKMKESREKARARARQRTSSKV 229
                          56667777999999999*********************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.2E-4198228IPR005333Transcription factor, TCP
PROSITE profilePS5136936.40199157IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.304211228IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MFPSTNYTSS GSYPRFPSSS SSSTSPYPSF TLLHPENSSS SNTFLCDPLA LTYIPSHYHA  60
PIIPETLANW AVADCAILNQ DLGGALYGIT NKPEKKATKK DRHSKIHTSQ GLRDRRVRLS  120
IEIARKFFDL QDMLGFDKAS NTLDWLFTKS KKAIKELTRS KHSADSFEFS SSSDGEVVST  180
IHQDLHQQQG VDLEEGKLKE PAAYCVKAKM KESREKARAR ARQRTSSKVL CNISSEGKVQ  240
DLKKKCPATE NPQILNQLRS PLQPPHPQDV GGEVPRDDDF NVIEESIVIR RKLKHTLMSS  300
IHHQNAVIPK EASVNNSDYH SFPNLSPNWE ANNNGANGRS TFCAIASMNL STGLQIFGKS  360
WEECTNPHPS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00215DAPTransfer from AT1G67260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G256400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530473.10.0transcription factor DICHOTOMA
TrEMBLK7L8W00.0K7L8W0_SOYBN; Uncharacterized protein
STRINGGLYMA08G28691.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.21e-31TCP family protein