PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G228900.1.p
Common NameGLYMA_08G228900, LOC102664782
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 435aa    MW: 47903.5 Da    PI: 7.1152
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G228900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1191.7e-3773131361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          +k l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+g+rknk+s
  Glyma.08G228900.1.p  73 NKVLPCPRCNSSETKFCYFNNYNVNQPRHFCKNCQRYWTAGGTIRNVPLGAGKRKNKHS 131
                          67899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2761129IPR003851Zinc finger, Dof-type
PfamPF027013.4E-3174130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.41676130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MNGLEESTND EVDVPLNEVS SKQIDPQEDG NSAPNIYKNP TLKLVAKVVN GNNEHRNAKR  60
DIDHQEKVLK RANKVLPCPR CNSSETKFCY FNNYNVNQPR HFCKNCQRYW TAGGTIRNVP  120
LGAGKRKNKH STLQYCLIPV TPDAASVSQT DSKPASDMLL SSSRLIKGME NISSLREETP  180
LSESLETVLS LNGQTNIEMA SSTLKDDAEE SSSSSMRSNE VEQVCLAQHS LVPLQSFQYY  240
PVPSWSYQWN PCWNVKELRP RSLSSRPVYT GSPTMIAVPG FSLPTVILPG VPYSYSGFMS  300
NWDEQKEDAS LVGSAFSGIS LSPSSVSNST CSGNRSPTLG KHSRDGSTLG EDAMKQNLWV  360
PKTVRINDPE EAANSSIWST LGTKSEQNKL IMKGSIFKSF EPKASASSHI LEDNQILRAN  420
PAAFSRSESF QESM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G228900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006585698.10.0cyclic dof factor 3 isoform X1
TrEMBLK7L8900.0K7L890_SOYBN; Uncharacterized protein
STRINGGLYMA08G24591.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-57cycling DOF factor 2