PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G212700.1.p
Common NameGLYMA_08G212700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 225aa    MW: 25989.5 Da    PI: 7.3473
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G212700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF374.2e-12950142
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         k+i+n++ r+ tf +R++g++ K + LS++C +e+++i++ +
  Glyma.08G212700.1.p  9 KPISNERSRKSTFKQRKEGLITKISQLSTMCRVEACLIVYDE 50
                         78*************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.965150IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-16177IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-9158IPR002100Transcription factor, MADS-box
CDDcd002663.76E-19282No hitNo description
PRINTSPR004043.2E-6323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-121150IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRKRITLKP ISNERSRKST FKQRKEGLIT KISQLSTMCR VEACLIVYDE MNDDVGTMTW  60
PKDPTLVRPI IENYESQRAE KPPNTFVIDD FFENRNNMIE SEISKLHKQA REIKYPSWDP  120
SLSNMGDEQL RAFIANVNAK IEACDQRIDM LKNTNQDEAN NINSMQNMHG SRQLNFMQNI  180
SQSQIIPTPA EPLVLNDNNG RVLNFANSTN QMDFKQITVI YFFF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G212700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533066.21e-126agamous-like MADS-box protein AGL103
RefseqXP_028246659.11e-126agamous-like MADS-box protein AGL103
TrEMBLI1KVF31e-166I1KVF3_SOYBN; Uncharacterized protein
STRINGGLYMA08G22700.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Representative plantOGRP3677621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-21M-type_MADS family protein