PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G148800.1.p
Common NameGLYMA_08G148800, LOC100805312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 378aa    MW: 41903 Da    PI: 6.5111
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G148800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.69.1e-18194248256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Lee F+++++++ +++  LAk+l+L+ rqV vWFqNrRa+ k
  Glyma.08G148800.1.p 194 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLQPRQVEVWFQNRRARTK 248
                          778899***********************************************98 PP

2HD-ZIP_I/II128.72.4e-41194284192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq+++LEesF+e+++L+p++K +la++L+lqprqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +
  Glyma.08G148800.1.p 194 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLQPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-A 282
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 lk 92 
                          lk
  Glyma.08G148800.1.p 283 LK 284
                          55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-18177244IPR009057Homeodomain-like
SuperFamilySSF466893.55E-19178251IPR009057Homeodomain-like
PROSITE profilePS5007117.281190250IPR001356Homeobox domain
SMARTSM003893.4E-16192254IPR001356Homeobox domain
CDDcd000863.53E-16194251No hitNo description
PfamPF000463.3E-15194248IPR001356Homeobox domain
PROSITE patternPS000270225248IPR017970Homeobox, conserved site
PfamPF021835.9E-11250284IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-26250293IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MELGLSLGDS SRPLLGFMEK PREATSNQLG LGFNTTLSIG PIITRQKDHQ QDEDEEYQDE  60
ETKPNNNNNT HRTEDPNDLC SKPNNNTVLH QLDFLPQLAL PWHPPSENGS LSSELGGSSR  120
GLDVNVQPPA AEDEAARSSS PNSAASSFQM DLCIYNSRGG SSNKRDFEGE AYDQRTSSRA  180
SDDDDNNGSG GNTRKKLRLS KEQSAFLEES FKEHNTLNPK QKLALAKQLN LQPRQVEVWF  240
QNRRARTKLK QTEVDCEYLK RCCETLTEEN RRLHKELQEL RALKTSNPFY MQLPATTLTM  300
CPSCERVATN STSTSSSMSA TINATNSGAT ACVKTGNNNN NNDSPSKPIG FPFGKPRFHP  360
FVHSSQQQLH QHQSSAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192198TRKKLRL
2242250RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.96900.0flower| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G148800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003531416.10.0homeobox-leucine zipper protein HOX11
RefseqXP_028243912.10.0homeobox-leucine zipper protein HOX11-like
SwissprotA2YW033e-87HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLA0A445JEV20.0A0A445JEV2_GLYSO; Homeobox-leucine zipper protein HOX27
TrEMBLK7L6T00.0K7L6T0_SOYBN; Uncharacterized protein
STRINGGLYMA08G15771.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-55homeobox from Arabidopsis thaliana