PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G147300.1.p
Common NameGLYMA_08G147300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 112aa    MW: 12934 Da    PI: 8.8109
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G147300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26027.77.3e-0925665596
               DUF260 55 edamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
                          + ++ l++eA++r++ P+yG++g+i+kl +q+++++  la+
  Glyma.08G147300.1.p 25 VNNLQILYFEAHCRIQGPIYGCAGIIFKLYEQINSAEIALAY 66
                         5667889***************************99988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.8E-62765IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MISFLFFKKK IDIMMSGSKF HHTYVNNLQI LYFEAHCRIQ GPIYGCAGII FKLYEQINSA  60
EIALAYIDIQ TQTACHKLQA ESNFDVLPAQ SSITAKFQWK RPYFKDADWS R*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G147300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595718.15e-28LOB domain-containing protein 24
RefseqXP_028201029.15e-28LOB domain-containing protein 24-like
TrEMBLK7L6R94e-78K7L6R9_SOYBN; Uncharacterized protein
STRINGGLYMA08G15591.17e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.19e-09LOB domain-containing protein 24